KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001533Help
Entry
ABBFA_001533      CDS       T00795                                 

Definition
phospholipase A1 precursor (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABBFA_001533
   00565 Ether lipid metabolism
    ABBFA_001533
   00590 Arachidonic acid metabolism
    ABBFA_001533
   00591 Linoleic acid metabolism
    ABBFA_001533
   00592 alpha-Linolenic acid metabolism
    ABBFA_001533
Enzymes [BR:abb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ABBFA_001533
    3.1.1.32  phospholipase A1
     ABBFA_001533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652252..1653403
Genome map
AA seq 383 aa AA seqDB search
MAFRQFERTSLQLSMGTLLSCLCASVAYADTLAPVKPASVDACVALASNADRLACYDAVF
KPSALPVVQAAVVPEPVKKIDKPVVQPETFKEKVVDKVSNIKVIGKAPTIEPTSSLLDQR
WELSEKSKLGVWNIRAYQPVYLLPVFWTSDKNEFPSSPNPNNTVTEAQNLKSTESKFQIS
LKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLGLD
GRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFALMLRPWIRIEEDSKDDNNPDME
DYIGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYG
ESLIDYNHRATYAGLGVSLMNWY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcagacaatttgaacgcacatctttacagctaagtatgggaaccctgcttagc
tgtttatgtgcgtcggtggcatatgccgacaccttagcccctgtaaaacctgcgagtgta
gatgcatgtgttgcccttgcttcgaatgctgatcgcctagcttgttatgatgctgtgttt
aaaccatcggccttaccggttgttcaagccgcagtagtaccagagcctgttaaaaaaatt
gataaacctgttgttcaacctgaaacatttaaagaaaaggttgtagataaggtaagtaat
atcaaagtaattggtaaagcacctacaattgaacctacttcttctttgctagatcaacgt
tgggagttgtctgaaaaaagcaaactgggtgtttggaatattcgtgcttatcaacctgtt
tacttgctaccagttttctggacgagcgataaaaatgagtttccaagcagtccaaaccca
aataatacggtgacagaagcccaaaaccttaaatcaactgaaagtaaattccagatttct
ttgaaaacgaaagcttgggaaaatatttttggtaacaatggtgacttgtgggtaggttat
actcaatcttcacgttggcagacctttaatgctgaagaatctcgtccattccgtgaaacg
aactatgagccagaagcaagtttaatgtttagaacaaactatgagttgcttggcttagat
ggtcgtttgcttggggtaactttaaatcaccagtcaaatggacgttcagatcctttatct
cgtagctggaaccgtgtcatctttaatgtgggtttagaacgcggtaactttgctttaatg
cttcgtccatggatacgcattgaagaagacagcaaagatgataataatccagatatggaa
gattacatcggtcgtggtgatttaactgctttttataagtggaagcaaaatgacttctca
ttaatgctacgtcactctttaaaaggtggtgatgattctcatggtgctgttcagtttgac
tgggctttcccgattagtggcaagctgcgcggacacttccaattatttaatggttatggt
gaaagcttaattgactataaccatcgtgcaacttatgccggtttgggtgtttcactcatg
aactggtactaa

DBGET integrated database retrieval system