KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001881Help
Entry
ABBFA_001881      CDS       T00795                                 

Definition
protein cysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ABBFA_001881
Enzymes [BR:abb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ABBFA_001881
Transfer RNA biogenesis [BR:abb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ABBFA_001881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2016576..2017433)
Genome map
AA seq 285 aa AA seqDB search
MFITTTCPNDALIEQLLPILEEASQILLQEYQNYSAGYEFTIEEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSKQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaacttgccccaatgatgctttaattgaacagctactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgaattt
acgattgaagaaaaacatgatgattcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccagttttatcggaagaaagt
gactatagtgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgaacaggtcgtttatttaggttattta
aaggatttaccctttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaaaacaagctcctgtacaaattggtttaagtcatagtagtaaaaatccgaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgtcgtgaagcgggt
agcgcttataagttttgtatgatgttagaaggcgagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaagccctttgaatataaccaacgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system