KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002137Help
Entry
ABBFA_002137      CDS       T00795                                 

Definition
(GenBank) Beta-ketoadipyl CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABBFA_002137
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_002137
   00640 Propanoate metabolism
    ABBFA_002137
   00650 Butanoate metabolism
    ABBFA_002137
  Lipid metabolism
   00071 Fatty acid degradation
    ABBFA_002137
   00072 Synthesis and degradation of ketone bodies
    ABBFA_002137
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABBFA_002137
   00310 Lysine degradation
    ABBFA_002137
   00380 Tryptophan metabolism
    ABBFA_002137
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABBFA_002137
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABBFA_002137
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABBFA_002137
Enzymes [BR:abb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABBFA_002137
Exosome [BR:abb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABBFA_002137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2277157..2278362
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatctatgatggtttgcgtagtccatttggccgtcatgcgggtgaa
cttgcctcaattcgtcctgatgatttagcagcaacggtcattcaaaaactacttgaaaaa
actggtgtaccgggcgcggatattgaagatgtgatcttaggcgacaccaaccaagcgggt
gaagacagtcgtaatgtggcacgcaacgcgctgttacttgcaggtttacctgtcactgtg
ccaggccagacagtaaaccgtctatgtgcgagtggtttaggtgcagtaattgattcagca
cgtgctattacttgtggtgaaggtgagctctatatcgcaggtggtgtagaaagtatgtct
cgcgcaccttttgtgatgggtaaagccgaaagtgcttatagccgtgatgcaaaaatttat
gacaccaccattggttctcgctttcccaataaaaaaattattgcgcagtacggcggtcat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagccgtgaacaagcc
gacttatttgcagctcaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gtcgatgaaattaccccaattgaggttttccaaggcaaaaaattgccacctaaactcgtt
tctgaagatgaacaccctcgtccaagctcaactgttgaagcactcacaaagttaaaacca
ctctttgaaggtggcgtggttacagctggtaatgcttcaggtattaatgatggtgcagca
gcactcttgattggttcagaagcagcgggtcaaaaatatggcctaaaaccaatggcaaaa
atcttgtccgctgcggcggctggtattgagccacgcattatgggtgcaggtcctattgaa
gccattaaaaaagctgttgcgcgcgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaggttttatcttgtttaaaaggcttaaatgttgatttt
aatgacccacgtgtgaacccgaacggtggcgcaattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcagggtcttgcaatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system