KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002425Help
Entry
ABBFA_002425      CDS       T00795                                 

Definition
Cholesterol oxidase precursor(CHOD) (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
abb  Acinetobacter baumannii AB307-0294
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2574538..2576208
Genome map
AA seq 556 aa AA seqDB search
MTINNYDYDYLIIGSGFGGSVSACRLTEKGYSVAVMEMGRRWKAEDFAKNNWNTRRWIWR
PGMKLFGYFNMRFFRHVTIICGNAVGGGSITYANTLLVPPEHIWDEGTWADAADWKNEMP
QHYAEAERMLGVTDNKIFGPADHMLKKMGEAVGVGHTFKPTRVATFFPPEGEEGGKTYPD
PYFNGEGPDRGTCTACGGCMTGCKHNAKNTLDKNYLYFAEKNGAKVYEETKVVDVKPLNG
KADGSDGYEVTTECSSSWFNKQRRTWRVRNVIFSASSLGTQEMLFRLKQSGSLPNISDDL
GNRVRTNAESILGVRFFGKDVDMSKGVAIGSSIYIDHDTHIEATRYQSGSDAMGLMCTYM
AKGKPGWTRIFFWLWALICHPFIFLRMSNPVSFARQTLIFLVMQTADASINMRLKRNWFW
PFGKVLSSEGKKLPVYIPQANAFTEKVAKMFNGHPMTTITEILFNVPFTAHCMGGCAIAS
SPERGVVDGQNRVFNYKNLYVVDGSMLGANLGVNPSLTITALAERAMSYIPAKHTLEEQA
YTQTQGEVLEAAKVSA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaacaattatgactatgattacctgattattggttcaggctttggtggtagt
gtttctgcttgccgtttaaccgaaaaaggctactcggttgccgtaatggaaatggggcga
cgctggaaagctgaagattttgctaaaaacaactggaatacccgccgttggatttggcgt
ccgggcatgaaacttttcggttatttcaacatgcgtttttttcgccatgtcaccattatt
tgcggtaatgccgtaggtggcggttcaattacctatgccaataccctactggttccacct
gaacatatttgggatgaaggcacgtgggcagatgccgcggactggaaaaatgaaatgcct
cagcactatgctgaagcagaacgtatgcttggcgtgactgataataaaattttcggccct
gccgaccacatgctaaagaaaatgggtgaagcagtcggtgttggccatacatttaaacct
actcgtgttgccactttctttccaccggaaggtgaagaaggtgggaagacctaccctgac
ccttattttaacggcgaaggtccagaccgtggcacttgtaccgcatgtggcggttgtatg
acgggttgtaaacacaacgcaaaaaatacattagataaaaactatttgtactttgccgaa
aaaaatggcgctaaggtttatgaagaaaccaaagtagttgacgttaaacctctcaatggt
aaagccgatggcagcgatggttatgaagtcacgactgaatgttcaagctcatggtttaac
aagcaacgtcgtacttggcgagttcgtaatgtgattttctctgcatcttctttaggcaca
caagagatgttgttccgtttaaaacagtccggttctctgccaaatatttctgatgatttg
ggtaatcgggttcgtaccaatgccgagtcgattttaggtgttcgtttttttggtaaagat
gtcgacatgagtaaaggtgttgctattggttcaagtatttacattgaccatgacactcac
attgaagcgactcgctaccaaagtggttcagatgccatgggccttatgtgtacttacatg
gctaaaggcaaaccgggttggacacgtattttcttttggttatgggcactcatttgccat
ccatttattttccttcgcatgagtaatcctgtcagttttgcacgtcaaaccttaattttc
ttggtgatgcaaaccgctgatgcctcaatcaacatgcgtttaaaacgcaattggttctgg
ccttttggcaaggtgttatcgagcgaaggtaaaaagctacctgtttatattccgcaggcc
aatgcatttaccgaaaaagttgccaaaatgtttaatggccaccccatgacgaccattacc
gaaattttgtttaacgtaccttttacagctcactgtatgggtggttgtgcaattgcttca
agtccagagcgtggtgtggtagatggacaaaatcgggtgtttaactataaaaacttatac
gttgtagatggttcaatgttaggtgcaaatttgggcgttaacccaagtctcaccattaca
gctctagcagaacgtgcaatgtcttatattccggctaaacatactttagaagaacaagct
tatactcaaactcagggtgaagttttagaagcagcaaaagtatctgcttaa

DBGET integrated database retrieval system