KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002625Help
Entry
ABBFA_002625      CDS       T00795                                 

Definition
Arylesterase precursor(Aryl-ester hydrolase) (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABBFA_002625
Enzymes [BR:abb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ABBFA_002625
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ABBFA_002625
Lipid biosynthesis proteins [BR:abb01004]
 Fatty acid synthase
  Component type
   ABBFA_002625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2786029..2786652
Genome map
AA seq 207 aa AA seqDB search
MYKSYLSGSKSLLLIALSMLPMLVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQY
PKQHKVVNASMSGETTSGALARLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQQNLSQL
VHLSQQQKAQVILFGMKIPPNYGTAYSKAFETNYKTVSQKYQVKLLPFFLDGVAGQKQLM
QNDLIHPNAQAQSKLLNLAYPYIKGAL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcttatttgtctggttctaaaagtctcttgctcatcgcattgagcatgttg
cctatgttggtctcggccaaaactattttaattttaggagatagtattagtgccggttac
ggaatagaccctaaacaaggttgggtacaattactacaaaaacgtctagaccaacagtat
cccaaacaacataaagtggtcaatgcaagtatgagtggtgaaaccacaagtggcgctttg
gccagattacctaagcttttacaaacgtataaacccgaagtcgtagttattgaattaggt
gggaatgatggtttacgaggtcaacccccacaaatgattcaacaaaatttgtcgcagctc
gtccatttaagccaacaacaaaaggcgcaggttattctttttggtatgaagattccgcct
aattatggcacagcttatagcaaagcatttgaaaccaattataaaactgtaagccaaaaa
tatcaggtgaaactgctaccgtttttccttgatggcgtcgctggacaaaaacaactaatg
caaaatgacttgattcatccaaatgcccaagcgcagtcaaaattacttaatttagcttat
ccatacataaaaggtgccctatag

DBGET integrated database retrieval system