KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002727Help
Entry
ABBFA_002727      CDS       T00795                                 

Definition
(GenBank) Phosphomannomutase/phosphoglucomutase(PMM/PGM)
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00030  Pentose phosphate pathway
abb00051  Fructose and mannose metabolism
abb00052  Galactose metabolism
abb00230  Purine metabolism
abb00500  Starch and sucrose metabolism
abb00520  Amino sugar and nucleotide sugar metabolism
abb00521  Streptomycin biosynthesis
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_002727
   00030 Pentose phosphate pathway
    ABBFA_002727
   00051 Fructose and mannose metabolism
    ABBFA_002727
   00052 Galactose metabolism
    ABBFA_002727
   00500 Starch and sucrose metabolism
    ABBFA_002727
   00520 Amino sugar and nucleotide sugar metabolism
    ABBFA_002727
  Nucleotide metabolism
   00230 Purine metabolism
    ABBFA_002727
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABBFA_002727
Enzymes [BR:abb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABBFA_002727
    5.4.2.8  phosphomannomutase
     ABBFA_002727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACJ56826
Position
complement(2899938..2901356)
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSATTISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgatcattggttatgatgcgcgcttaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacatatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaacttaagcgtcctttaaaagttgtattagat
ggcctgcatggatcggcagggcactgctcaaaactcgtacttgaaaaaatgggctgtgaa
gtcattgctttacgtacaactccaaatggtgagttccctgatcatgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggcgatggcgaccgtgtcgtattgcttgatgaaaaagccaatatactt
accgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcactcatggttcaaagaaccgtagaacgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctccgcgcgtatttatctcaatca
aatggtaacgccatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgacgatggtttgtacgctgcattacgtgtaatggaatatttcaccgag
tcgagtgcgacaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggcacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system