KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002778Help
Entry
ABBFA_002778      CDS       T00795                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABBFA_002778 (ipk)
Enzymes [BR:abb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ABBFA_002778 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2953556..2954389
Genome map
AA seq 277 aa AA seqDB search
MIRVPSPAKLNLFLHITGRRENGYHELQTIFQLIDLYDWMTFTPISEDEIQIEGLGEVQL
EQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGGSSNAATTLIVLNQLWQCGLTE
EQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQKQFIVLKPDCFISTQLLFSQK
TLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEAMQYLDQFGHAKLTGTGACVFA
EVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaccttctccagctaagctcaacctgtttttgcatatcacaggacgtcgt
gaaaatggttaccatgaactacaaaccattttccaacttattgatttatatgactggatg
acatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaactt
gagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatccttgc
ggactccatataaaaattgaaaaaaatattccgatgggtgctggtttaggtggcggttct
tccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaactgaa
gaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttatggg
ttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaaaaa
caattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaaaaa
acattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttctaat
ttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagcaatg
caatatctcgaccaatttggtcatgcaaagcttacaggtacaggtgcttgtgtttttgct
gaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagcttac
ttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system