KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002778Help
Entry
ABBFA_002778      CDS       T00795                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:abb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2953556..2954389
Genome map
AA seq 277 aa AA seqDB search
MIRVPSPAKLNLFLHITGRRENGYHELQTIFQLIDLYDWMTFTPISEDEIQIEGLGEVQL
EQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGGSSNAATTLIVLNQLWQCGLTE
EQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQKQFIVLKPDCFISTQLLFSQK
TLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEAMQYLDQFGHAKLTGTGACVFA
EVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaccttctccagctaagctcaacctgtttttgcatatcacaggacgtcgt
gaaaatggttaccatgaactacaaaccattttccaacttattgatttatatgactggatg
acatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaactt
gagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatccttgc
ggactccatataaaaattgaaaaaaatattccgatgggtgctggtttaggtggcggttct
tccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaactgaa
gaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttatggg
ttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaaaaa
caattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaaaaa
acattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttctaat
ttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagcaatg
caatatctcgaccaatttggtcatgcaaagcttacaggtacaggtgcttgtgtttttgct
gaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagcttac
ttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system