KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003077Help
Entry
ABBFA_003077      CDS       T00795                                 

Definition
Dihydrofolate reductase type 3(Dihydrofolate reductasetype III) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABBFA_003077
   00670 One carbon pool by folate
    ABBFA_003077
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABBFA_003077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3277516..3278061
Genome map
AA seq 181 aa AA seqDB search
MAWQNVEVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKNNFLVAYAQYRN
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtagaagttgtccacgttgtcgcaatggataaaaatcactgtatt
ggtaaaggcaatgcgttgccatggcatatctctgccgatttaaaacattttaaagaaatc
acccaaggtggtgtggtgatcatgggccgcaaaacgcttgagtctatgggccgtgctcta
ccgaaccgtgtgaactgggtgattacccgtgacattaactggcattttgacggcgtaaaa
attgcgtattcaattgaagatgctttaaatgctgctttagaagatgccaaaaacaccgaa
aagcaagctttattcattattggtggtggtgaaatctttaagcaaaccttgtcaattgca
gaccgtcttgagctcactcatgttgacttagatgtacaaggtgatgcacattatccaaca
ataccgagtgaatttcacaaaactgcaagcgaacagcaagtagatgaaaaatcaggaact
tcattcgaatttgccacttataaaaataattttctggtcgcctatgcacaatatcggaac
acgtga

DBGET integrated database retrieval system