KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003206Help
Entry
ABBFA_003206      CDS       T00795                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABBFA_003206 (tpiA)
   01230 Biosynthesis of amino acids
    ABBFA_003206 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_003206 (tpiA)
   00051 Fructose and mannose metabolism
    ABBFA_003206 (tpiA)
   00562 Inositol phosphate metabolism
    ABBFA_003206 (tpiA)
Enzymes [BR:abb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABBFA_003206 (tpiA)
Exosome [BR:abb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABBFA_003206 (tpiA)
  Exosomal proteins of bladder cancer cells
   ABBFA_003206 (tpiA)
  Exosomal proteins of melanoma cells
   ABBFA_003206 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3413913..3414707)
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTSAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgcccttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtactggtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttttacagcaaatttgtgat
attgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcatgct
aaaattcgtgaaggcttatgccaacttacatcagccggctcaaatattgctattttgtat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system