KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003230Help
Entry
ABBFA_003230      CDS       T00795                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:4.2.1.17 5.1.2.3 1.1.1.35 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABBFA_003230 (fadB)
   01212 Fatty acid metabolism
    ABBFA_003230 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABBFA_003230 (fadB)
   00650 Butanoate metabolism
    ABBFA_003230 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ABBFA_003230 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ABBFA_003230 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABBFA_003230 (fadB)
   00310 Lysine degradation
    ABBFA_003230 (fadB)
   00380 Tryptophan metabolism
    ABBFA_003230 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABBFA_003230 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABBFA_003230 (fadB)
   00281 Geraniol degradation
    ABBFA_003230 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ABBFA_003230 (fadB)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABBFA_003230 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABBFA_003230 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABBFA_003230 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     ABBFA_003230 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3439042..3441195
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
VKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANN
LLTKQVERKKMKPVQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgcttgcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaattcaaccgtgcaacaattgaagatttc
aaagctgctatcgcggctgtaaaagctaataacgatattaaaggcttagttgttacctcg
ggcaaatctacattcattgttggtgcagatattaccgaatttggtcaaaactttgcacaa
ggcgaaaaagcgattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagaccttccaaaagttgctgctattaacggcatggctttgggtggtggttttgaa
atgtgtttagtttgtgactatcgcgtgatgtcagaagctgcacaagtcggtttaccagaa
atcaaactcggtatttaccctggtttcggtggtagtgttcgtttaagccgtctcattggt
attgataatgcagttgaatggatggcaatggctactccaaagaaaccggctgctgcactt
aaagatggcgctgtagatgctgtggttgctgcggacaaattacttgacgctgctactgat
ctggttaagcaagcgatttctggtcgtttaaactggaaagcaaaacgccaagaaaaactt
gaagctgtaaaattgaacccacttgaacaaatgatggcgttcaacacagcaaaaggtgcg
gtacttgctaaagcaaatcctgctcaataccctgctccaaaattattacttgattcatta
caagctggtgcaagccttgcacgtgatgaagcgttaaaagctgaggctgaaggctttgcc
aaagcagccgtaactcctcaagctgaagcattaattggtttattcattaatgaccaagtt
gttaaaaaagcatctaagcaacatgaaaagggtgctcatcctgtaaaccaagctgctgta
cttggcgcgggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggcactcca
atcatcatgaaagatattggtaacccacaacttgcattaggtatgaaagaagcaaacaac
ttgttaaccaagcaagttgaacgcaagaaaatgaaacctgtgcaaatgggtgaaacactt
gctcgcatccgtcctactttaagctacgaagagtttaaagaagtcgacatcgtgatcgaa
gcggtaactgaaaatccaaaagtaaaagaaatcgtacttgctgaaactgagaaaaatgtt
cgtgaaaacacgatcattgcttctaacacctctactatttcaattacacgtttagcaaaa
gcattacaacgtcctgaaaactttgttggtatgcacttcttcaacccagttcacatgatg
ccacttgttgaagttattcgtggtgaaaaaacttctgaagaagcaattgcaactacggtc
gtgcttgctcaaaaaatgggtaaaacaccaatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttacttcggagcatttgaccttcttgtaaaagacggcgca
gatttccagcaaatcgacaatgtaatgtctaagttcggttggccaatgggtcctgcttat
ctgatcgatgttgtaggtatcgatacaggtgtacatggtgctgaagtgatggctgaaggt
ttccctgaccgtatgaagccagactacaaaggcgcgatcgaagcaatgtacgaagcgaag
cgtcttggtcaaaagaatgatgtaggtttctacaaatacgaactcgacaagaaaggcaag
aaagcaaaaactgttgatccaacagcgtatgaagtgattgctccattcgtaactggcgaa
aaacgcgaatttgataaccaagaaattattgaccgtatgatgcttgctctttgcaatgaa
actgttcgttgcttagaagacaacattgtagcgactgcatctgaggcagacatggcaatg
attatgggtattggtttccctccattccgtggtggtccatgccgttacatcgaccaaaca
ggtgttgctgaatatgttgcactctgcgacaaatatgcgcacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system