KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003294Help
Entry
ABBFA_003294      CDS       T00795                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00260  Glycine, serine and threonine metabolism
abb00750  Vitamin B6 metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01230  Biosynthesis of amino acids
Module
abb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABBFA_003294 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABBFA_003294 (thrC)
Enzymes [BR:abb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABBFA_003294 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACJ59250
Position
3505401..3506540
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gccgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaatccgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgatcaattcactggtccaaaaccagaaggcttaccaacaatggta
ggttatcaagcttctggcgcagctcctttcttacgtggtgctccagtagaaaaaccggaa
acagttgcaactgcgattcgtattggtaacccacaaagctggaaccatgcaaaagccgta
gtacgtgactctaaaggttggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggtgtatttgttgagccagcatctgctgcttctattggc
ggtgcaatccgtgatattaaagcgggtaaaattgctgaaggttctgtcattgtatgtact
gtaacgggtaatggcttgaaagaccctgatacagcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system