KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003305Help
Entry
ABBFA_003305      CDS       T00795                                 

Definition
DNA polymerase III chi subunit, HolC family protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABBFA_003305
   00240 Pyrimidine metabolism
    ABBFA_003305
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ABBFA_003305
   03430 Mismatch repair
    ABBFA_003305
   03440 Homologous recombination
    ABBFA_003305
Enzymes [BR:abb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABBFA_003305
DNA replication proteins [BR:abb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABBFA_003305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3518199..3518606
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPISFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgatcagctttatt
gcccatggcgttgatcaggtagatgcagcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtctaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system