KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003317Help
Entry
ABBFA_003317      CDS       T00795                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABBFA_003317
Enzymes [BR:abb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ABBFA_003317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3528820..3529596
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttattcgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacacccagaggtgaactgtattatccatacg
catcctacctatgtagcggccctgtcgatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagattgctcatttgtaggccattggccgggtgttcctgta
ggcaacgaagaaggtattttgatttcttctgctctgggtaaaaaccgcgctgttttgttg
tctcaccacggtcaattggtcacaggaaaaactatcgaagaagcctgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgctggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtgtctactgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system