KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003362Help
Entry
ABBFA_003362      CDS       T00795                                 

Definition
Vitamin B12 transport periplasmic protein btuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABBFA_003362
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABBFA_003362
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABBFA_003362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3576987..3577532
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQVLTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEEELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggtttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagagcctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagtgctaacaacagctcaaccagaacgtattgga
gaaggtcctttccgtgaacgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaacttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gctcctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagaagaattagct
aaataa

DBGET integrated database retrieval system