KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003362Help
Entry
ABBFA_003362      CDS       T00795                                 

Definition
Vitamin B12 transport periplasmic protein btuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:abb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:abb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3576987..3577532
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQVLTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEEELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggtttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagagcctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagtgctaacaacagctcaaccagaacgtattgga
gaaggtcctttccgtgaacgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaacttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gctcctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagaagaattagct
aaataa

DBGET integrated database retrieval system