KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003414Help
Entry
ABBFA_003414      CDS       T00795                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00620  Pyruvate metabolism
abb00640  Propanoate metabolism
abb00680  Methane metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_003414
   00620 Pyruvate metabolism
    ABBFA_003414
   00640 Propanoate metabolism
    ABBFA_003414
  Energy metabolism
   00680 Methane metabolism
    ABBFA_003414
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABBFA_003414
Lipid biosynthesis proteins [BR:abb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABBFA_003414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACJ57322
Position
complement(3630633..3632282)
Genome map
AA seq 549 aa AA seqDB search
MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTF
RELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAAWRIGAVYQPLFTAFGPKA
IEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQGTPLKAGDFNFWNEVKQQSDQ
CDLVMRNIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPG
WAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQ
MAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQTEVGMVVCNHHGLKHEIHAG
SAGFPSPGYRVAIVNEQGEELPPETPGILAVDISQSPMMWFGGYKESRKSPFIGHYYLTG
DTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALLEHDAVIEAAVIGVPDPDRTEVV
KAFVILAAGVQPSDALAEELSQFVKRRLSAHAYPRLVEFVSELPKTPSGKIQRFLLRNQE
IAKQQAKAG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgatggattatcaaaatgctgtacaggctttcgatttggaaagcactgctaaacagatg
ttgtcaggttcactcgatgcactgaacgcatgttatgaatgttgtgatagacatgcagat
ggcgacaagatcgcgctgtactggcaaggaaaagacggtcgcaaagaacaatataccttc
cgtgaactaaaagaatggtcgagtcagtttgctaactttttaaaatcacaaggtgtgaaa
gcgggagaccgtatttcaggcttattgccaagaacacctgaactgatcgtgaccattttg
gcggcttggcgaattggtgcggtgtaccaacccctatttactgcctttggtcccaaagcg
attgagcaccgtattcaacttgctcaaagtaagctagtggtgaccgatatgggcaaccgt
agcaagctcgacgaaattgaaaagtgccctgcaattatgacagtggccgacgcacaaggt
actccgcttaaagcaggtgattttaatttctggaatgaagtgaagcagcagtccgatcaa
tgtgatctggtgatgcgtaacatccaagatcctttcttgcttatgtttacgtctggcact
acaggaccagcgaaaccattggaagtgccactaaaagcactgattgcttttggtcgctat
atgcaagatgccattggtttaaccgaagaggattcattctggaatattgcagatccgggt
tgggcgtatgggttgtactatgcgattactggaccgttatttttaggccatgccactttg
ttctatgaaggcggttttagtaccgatagcctatgccaaattgtgaaagattataaggtt
aacaacttggcaggtgcaccaacggcttaccgcatgatgatggcagctgacccagcacaa
atggcaccgttaaaaggacaattccgtgtggtgagtagtgcaggagagccgctaaatccg
gaagtaattcgttggtttaaacaagtccttgatgctccaatttatgaccactacgggcaa
actgaagtgggcatggtggtgtgtaatcatcatggtttaaaacatgaaattcatgctggt
tcagcaggttttccaagtccgggctatcgtgttgcgattgttaatgaacaaggtgaagag
cttccgccagaaacaccgggaattttagcagtcgacattagccagtctccaatgatgtgg
tttggtggctataaagaaagtcgtaaatcacctttcatcggtcattactacttaacgggt
gatactgccgagctacatgccgatggcagtatgagctttgtcggccgtagcgatgatgtg
atcaccacatcgggttatcgtattggacctttcgatgtggaaagcgcactacttgaacac
gacgctgtgattgaagccgcagtaataggcgtgcctgatccggatcgcactgaagtggtt
aaggcttttgtaattttagctgcgggcgtacaaccttcagatgcgcttgctgaagaactc
agccagtttgttaaaagacgactttctgctcatgcttacccacgattagttgaatttgtg
agtgaattacctaaaactccaagtggcaaaattcagcgctttttattgcgtaatcaagaa
attgctaaacaacaagctaaagcagggtaa

DBGET integrated database retrieval system