KEGG   Acinetobacter baumannii AB307-0294: ABBFA_003524Help
Entry
ABBFA_003524      CDS       T00795                                 

Definition
Thiol:disulfide interchange protein dsbC precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3754158..3754856)
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPT
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctgggctatatagtgctaatctggaccagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggctctatgattcggttaaaagaccaaaag
aacttaactaaagatctggttttaggacagaactcaattgattggaaacagttgccttta
aaagatgccattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaagcagcttgaacctgaactcgacaagcttaaagatgtcact
atttacacttttatctatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaacg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgatctgcc
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system