KEGG   Acinetobacter baumannii ACICU: ACICU_00088Help
Entry
ACICU_00088       CDS       T00710                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACICU_00088
   00052 Galactose metabolism
    ACICU_00088
   00500 Starch and sucrose metabolism
    ACICU_00088
   00520 Amino sugar and nucleotide sugar metabolism
    ACICU_00088
Enzymes [BR:abc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACICU_00088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
95867..96742
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDIVEAYRMQGQTFDCGSKIGYLKAVLHYGIEHPKLGNDFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagttttaccagtagccggtttaggtacacgttttctacccgcaagt
aagtctattccaaaggaaatggttaccgttgttgatcgtcctgcaattgaatatgtagta
cgagaagcggtagaagctggaattgagcaaattattttggttactcattcatcgaaagca
tcaattgaaaattattttgatcgtaactttgagttggaaaccactctagagcaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgcctgagcatgtgagtgtagtaagt
gttagacaacctcagcctttaggcctagggcatgctgttttatgtgcaaagagtgttgtt
ggtcaagatgattttgctgtgctattaccagatgtattagtgaaagatagctctggacaa
aatgatctatctcgtatgatttctcgttacaactcaagccaagctgctcaaatcatggtt
gaggcagtgccagaccatttagtggaccaatatgggattgtggatgtaaaacatagccca
aatgaaggtgaaagtattgctatgcagggtattgttgaaaagcctgcagtaggctctgca
ccatcaaacttatctgtggttggtcgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatattgttgaagcttatcgtatgcaaggtcaaacatttgattgtggtagt
aaaattggctatttaaaagctgtactacactatggaattgaacaccctaagttaggaaat
gattttaaacagttgattcaggaacttaaattataa

DBGET integrated database retrieval system