KEGG   Acinetobacter baumannii ACICU: ACICU_00131Help
Entry
ACICU_00131       CDS       T00710                                 

Definition
acyl-coenzyme A synthetases/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACICU_00131
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACICU_00131
   00620 Pyruvate metabolism
    ACICU_00131
   00640 Propanoate metabolism
    ACICU_00131
  Energy metabolism
   00680 Methane metabolism
    ACICU_00131
Enzymes [BR:abc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACICU_00131
Lipid biosynthesis proteins [BR:abc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACICU_00131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147529..149178
Genome map
AA seq 549 aa AA seqDB search
MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTF
RELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAAWRIGAVYQPLFTAFGPKA
IEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQGTPLKAGDFNFWNEVEQQSDQ
CDLVMRSIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPG
WAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQ
MAPLKGQFRVVSSAGEPLNPEVIRWFKQVFDAPIYDHYGQTEVGMVVCNHHGLKHEIHAG
SAGFPSPGYRVAIVNEQGEELPPDTPGILAVDISQSPMMWFGGYKESRKSPFIGHYYLTG
DTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALLEHDAVIEAAVIGVPDPDRTEVV
KAFVILAAGVQPSDALAEELSQFVKRRLSAHAYPRLVEFVSELPKTPSGKIQRFLLRNQE
IAKQQAKAG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgatggattatcaaaatgctgtacaggctttcgatttggaaagcactgctaaacagatg
ttgtcaggttcactcgatgcactgaacgcatgttatgaatgttgtgatagacatgcagat
ggcgacaagatcgcgctgtactggcaaggaaaagacggtcgcaaagaacaatataccttc
cgtgaactaaaagaatggtcgagtcagtttgctaactttttaaaatcacaaggtgtaaaa
gcgggtgaccgtatttcaggcttattaccaagaacacctgaactgattgtgactatttta
gcggcttggagaattggtgcggtgtaccaacccctatttactgcctttggtcccaaagcg
attgagcaccgtattcaacttgctcaaagtaagctagtggtgaccgatatgggcaaccgt
agcaagctcgacgaaattgaaaagtgccctgcaattatgacagtggccgacgcacaaggt
actccgcttaaagcaggtgattttaatttctggaatgaagtggagcagcagtccgatcaa
tgtgatctggtgatgcgtagcatccaagatcctttcttgcttatgtttacgtctggcact
acaggaccagcgaaaccattggaagtgccactaaaagcattgattgcttttggtcgatat
atgcaagatgccattggtttaactgaagaagattcgttctggaatattgcagatccgggt
tgggcgtatggtttgtattatgcgattactggaccgttatttttaggccatgccactttg
ttctatgaaggcggttttagtaccgatagcctatgccaaattgtgaaagattataaagtt
aacaacttggcaggtgcaccaaccgcttaccgcatgatgatggcagctgacccagcacaa
atggcgccgttaaaaggacaattccgtgtggtgagtagtgcaggagagccgctaaatcca
gaagtcattcgctggtttaaacaagtctttgatgctccaatttatgaccactacgggcaa
actgaagtaggcatggtggtgtgtaatcatcatggtttaaaacatgaaattcatgctggt
tcagcaggttttccaagtccgggctatcgtgttgcgattgttaatgaacaaggtgaagag
cttccgccagacacaccgggaattttagcagtcgacattagccagtctccaatgatgtgg
tttggtggctataaagaaagtcgtaaatcacctttcatcggtcattactacttaacgggt
gatactgccgagctacatgccgatggcagtatgagctttgtcggccgtagcgatgatgtg
atcaccacatcgggttatcgtattggacctttcgatgtagaaagcgcactacttgaacac
gacgctgtgattgaagccgcagtaataggcgtgcctgatccggatcgcactgaagtggtt
aaggcttttgtaattttagctgcgggcgtacaaccttcagatgcgcttgctgaagaactc
agccagtttgttaaaagacgactttctgctcatgcttacccacgattagttgaatttgtg
agtgaattacctaaaactccaagtggcaaaattcagcgctttttattgcgtaatcaagaa
attgctaaacaacaagctaaagcagggtaa

DBGET integrated database retrieval system