KEGG   Acinetobacter baumannii ACICU: ACICU_00261Help
Entry
ACICU_00261       CDS       T00710                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACICU_00261
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACICU_00261
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACICU_00261
Enzymes [BR:abc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACICU_00261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(284364..285503)
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gctgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgatcaattcactggtccaaaaccagaaggcttaccaacaatggta
ggttatcaagcttctggcgcagctcctttcttacgtggtgctccagtagaaaaaccggaa
acagttgcaactgcgattcgtattggtaacccacaaagctggaaccatgcaaaagctgta
gtacgtgactctaaaggttggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggtgtatttgttgagccagcatctgctgcttctattggc
ggtgcaatccgtgatattaaagcgggtaaaattgctgaaggttctgtcattgtatgtact
gtaacgggtaatggcttgaaagaccctgatacagcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system