KEGG   Acinetobacter baumannii ACICU: ACICU_00285Help
Entry
ACICU_00285       CDS       T00710                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:abc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309537..310304
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLSQLYQQLTGAQAIVVVS
PTAVDVGMQYLTQSGLKIDELKHIQWIAVGQATANRLHDYGIEAHVPEVETSEGMLNLPL
LHHMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRQCPQASYSTFKHLTQNSNY
NLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQLVKDYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattaatacccgacctgactcgcgtgcggctgaattaactcatgctttgcag
aataaggggtttcaggtcgagtctttacctcttttagaactggttgctcaacctttttca
gaatcactctctcaactctatcagcagttaactggcgcacaagcgattgtagtggttagt
cccactgctgttgatgtggggatgcagtatttaacacaaagtggtttaaaaatagatgag
ctaaaacatattcaatggattgcggtggggcaggcgacggctaatcgtcttcacgactat
gggattgaagcgcatgttcctgaggttgaaacttccgagggaatgcttaacttgcctctt
cttcatcatatgcaaaaatcaggtagtgtggctttttggagaggggaaggcggccgtcaa
tttatgatggaaactttgcaacagcaaggaattcagattttaaattttgttctatatcgc
cggcagtgtccgcaagcttcatattcgacattcaaacatctgacacagaattcaaattat
aatttagataaatggctcgtcttaattaccagtgaggcgagctggaaatactggttagag
ctttgtttaaaaaataaggcacaacctgattgcgtatatttagttttaggaccacgcctt
tttcaacttgttaaagactatcgcgatcagcaacaagctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

DBGET integrated database retrieval system