KEGG   Acinetobacter baumannii ACICU: ACICU_00322Help
Entry
ACICU_00322       CDS       T00710                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00071  Fatty acid degradation
abc00280  Valine, leucine and isoleucine degradation
abc00281  Geraniol degradation
abc00310  Lysine degradation
abc00362  Benzoate degradation
abc00380  Tryptophan metabolism
abc00410  beta-Alanine metabolism
abc00640  Propanoate metabolism
abc00650  Butanoate metabolism
abc00903  Limonene and pinene degradation
abc00930  Caprolactam degradation
abc01040  Biosynthesis of unsaturated fatty acids
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
abc01212  Fatty acid metabolism
Module
abc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACICU_00322
   00650 Butanoate metabolism
    ACICU_00322
  Lipid metabolism
   00071 Fatty acid degradation
    ACICU_00322
   01040 Biosynthesis of unsaturated fatty acids
    ACICU_00322
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACICU_00322
   00310 Lysine degradation
    ACICU_00322
   00380 Tryptophan metabolism
    ACICU_00322
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACICU_00322
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACICU_00322
   00281 Geraniol degradation
    ACICU_00322
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACICU_00322
   00930 Caprolactam degradation
    ACICU_00322
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ACICU_00322
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACICU_00322
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ACICU_00322
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ACICU_00322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: ACC55634
UniProt: B2I2J9
Position
complement(350521..352674)
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
VKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANN
LLTKQVERKKMKPAQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgcttgcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaattcaaccgtgcaacaattgaagatttc
aaagctgctatcgcggctgtaaaagctaataacgatattaaaggcttagttgttacctcg
ggcaaatctacattcattgttggtgcagatattaccgaatttggtcaaaactttgcacaa
ggcgaaaaagcgattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagaccttccaaaagttgctgctattaacggcatggctttgggtggtggttttgaa
atgtgtttagtttgtgactatcgcgtgatgtcagaagctgcacaagtcggtttaccagaa
atcaaactcggtatttaccctggtttcggtggtagtgttcgtttaagccgtctcattggt
attgataatgcagttgaatggatggcaatggctactccaaagaaaccggctgctgcactt
aaagatggcgctgtagatgctgtggttgctgcggacaaattacttgacgctgctactgat
ctggttaagcaagcgatttctggtcgtttaaactggaaagcaaaacgccaagaaaaactt
gaagctgtaaaattgaacccacttgaacaaatgatggcgttcaacacagcaaaaggtgcg
gtacttgctaaagcaaatcctgctcaataccctgctccaaaattattacttgattcatta
caagctggtgcaagccttgcacgtgatgaagcgttaaaagctgaggctgaaggctttgcc
aaagcagccgtaactcctcaagctgaagcattaattggtttattcattaatgaccaagtt
gttaaaaaagcatctaagcaacatgaaaagggtgctcatcctgtaaaccaagctgctgta
cttggcgcgggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggcactcca
atcatcatgaaagatattggtaacccacaacttgcattaggtatgaaagaagcaaacaac
ttgttaaccaagcaagttgaacgcaagaaaatgaaacctgcgcaaatgggtgaaacactt
gctcgcatccgtcctactttaagctacgaagagtttaaagaagtcgacatcgtgatcgaa
gcggtaactgaaaatccaaaagtaaaagaaatcgtacttgctgaaactgagaaaaatgtt
cgtgaaaacacgatcattgcttctaacacctctaccatttcaattacacgtttagcaaaa
gcattacaacgtcctgaaaacttcgttggtatgcacttcttcaacccagttcacatgatg
ccacttgttgaagttattcgtggtgagaaaacttctgaagaagcaattgcaactacggtc
gttcttgctcaaaaaatgggtaaaacaccaatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttacttcggagcatttgaccttcttgtaaaagacggcgca
gatttccagcaaatcgacaatgtaatgtctaagttcggttggccaatgggtcctgcttat
ctgatcgatgttgtaggtatcgatacaggtgtacatggtgctgaagtgatggctgaaggt
ttccctgaccgtatgaagccagattacaaaggcgcgatcgaagcaatgtacgaagcgaag
cgtcttggtcaaaagaatgatgtaggtttctacaaatacgaactcgacaagaaaggcaag
aaagcaaaaactgttgatccaacagcgtatgaagtaattgctccattcgtaactggcgaa
aaacgcgaatttgataaccaagaaattattgaccgtatgatgcttgctctttgcaatgaa
actgttcgttgcttagaagacaacattgtagcgactgcgtctgaggcagacatggcaatg
attatgggtattggtttccctccattccgtggtggtccatgccgttacatcgaccaaaca
ggtgttgctgaatacgttgcactttgcgacaaatatgcgcacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system