KEGG   Acinetobacter baumannii ACICU: ACICU_00946Help
Entry
ACICU_00946       CDS       T00710                                 

Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACICU_00946
Enzymes [BR:abc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ACICU_00946
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ACICU_00946
Lipid biosynthesis proteins [BR:abc01004]
 Fatty acid synthase
  Component type
   ACICU_00946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1056359..1056919)
Genome map
AA seq 186 aa AA seqDB search
MFVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQYPKQHKVVNASVSGETTSGALA
RLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQLIQLSQKQKAKVILFGMKIPPN
YGTAYSKAFENSYKTVSQKYQVKLLPFFLDGVAGQKQLMQNDLIHPNTQAQSKLLNLAYP
YIKGAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtctcggcaaaaactattttaattttaggagatagtattagtgccggttatgga
atagaccctaaacaaggttgggtacaattactacaaaaacgtttagaccaacagtatccc
aaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagtggcgctttggca
cgattaccaaaacttttacaaacgtataaacccgaggtagttgttattgaattaggcggg
aatgatggcttacgtggtcaaccaccacaaatgattcaaaaaaatctgtctcagctcatt
caattaagccagaagcaaaaagccaaggttattctttttggtatgaagattccgcccaat
tatggcacggcttatagcaaagcattcgaaaatagctacaaaactgtaagtcaaaaatat
caggtgaaattgctaccgttttttcttgatggcgtcgctgggcaaaagcaactaatgcaa
aatgacttgattcatccaaatacccaagcacaatcaaaattactgaatttagcttaccca
tacataaaaggtgccctatag

DBGET integrated database retrieval system