KEGG   Acinetobacter baumannii ACICU: ACICU_00946Help
Entry
ACICU_00946       CDS       T00710                                 

Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1056359..1056919)
Genome map
AA seq 186 aa AA seqDB search
MFVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQYPKQHKVVNASVSGETTSGALA
RLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQLIQLSQKQKAKVILFGMKIPPN
YGTAYSKAFENSYKTVSQKYQVKLLPFFLDGVAGQKQLMQNDLIHPNTQAQSKLLNLAYP
YIKGAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtctcggcaaaaactattttaattttaggagatagtattagtgccggttatgga
atagaccctaaacaaggttgggtacaattactacaaaaacgtttagaccaacagtatccc
aaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagtggcgctttggca
cgattaccaaaacttttacaaacgtataaacccgaggtagttgttattgaattaggcggg
aatgatggcttacgtggtcaaccaccacaaatgattcaaaaaaatctgtctcagctcatt
caattaagccagaagcaaaaagccaaggttattctttttggtatgaagattccgcccaat
tatggcacggcttatagcaaagcattcgaaaatagctacaaaactgtaagtcaaaaatat
caggtgaaattgctaccgttttttcttgatggcgtcgctgggcaaaagcaactaatgcaa
aatgacttgattcatccaaatacccaagcacaatcaaaattactgaatttagcttaccca
tacataaaaggtgccctatag

DBGET integrated database retrieval system