KEGG   Acinetobacter baumannii ACICU: ACICU_00968Help
Entry
ACICU_00968       CDS       T00710                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:abc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:abc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1082263..1083867
Genome map
AA seq 534 aa AA seqDB search
MTTYQTAIDAVRELKAKFGNTWADISPEDAARMQLQNRFKTGLDIAKYTAAIMRRDMAEY
DADSSKYTQSLGCWHGFIAQQKMIANKKYFGTTSKRYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLRQADAKELNDLFRALNKAKEAGDSAKVAEITAQIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQAGKVTVPHEDFIAKI
HALRYAFLEMGVEDGVIVARTDSEGADLTQKIPVVKEPGDIASKYISYLDTQEIDISEAQ
EDEILIKRDGKLHRPTRLASGLYQFREGTQIDRVVLDCITSLQNGADLLWIETPTPNVQE
IAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYD
NTELAAEADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAQGYFGDQGMLAYVA
GVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGENALKAGDDAKNTMNQFSAH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactacatatcaaacagcgattgatgcagtacgtgaattaaaagcaaaattcggcaac
acttgggcagacattagcccagaagatgctgctcgtatgcaacttcaaaaccgtttcaaa
acaggtttagatattgctaagtatacagctgcgattatgcgtcgtgatatggctgaatac
gatgctgattcaagcaaatatactcaatcattaggttgctggcatggtttcatcgctcaa
caaaaaatgattgctaacaaaaagtatttcggtacgacaagcaaacgttatatctacctt
tctggttggatggttgctgctcttcgttcagaatttggtccacttcctgaccaatctatg
cacgagaaaacttcagtacctgctttgatcgaagaaatctacactttcttacgtcaagct
gatgcaaaagaattaaatgacttgttccgtgctttaaataaagcaaaagaagctggtgac
tctgcgaaagtagctgaaatcacagctcaaatcgacaacttcgaaactcatgttgtgcca
attattgcagacatcgatgctggtttcggtaacgaagaagcaacttacttacttgctaag
aaaatgattgaagctggtgcttgtgcgcttcaaatcgaaaaccaagtatctgatgcaaaa
caatgtggtcaccaagctggtaaagtaactgttccacatgaagacttcatcgctaagatc
catgcacttcgttatgcattcttagaaatgggtgttgaagacggtgttatcgttgctcgt
actgactctgaaggcgctgacttaactcagaagatccctgtagttaaagagccaggtgat
atcgcatctaaatatattagctacttagatactcaagaaattgatatctcagaagctcaa
gaagatgagatcttaattaaacgtgatggtaaattacatcgtccaactcgtttagcttct
ggtctataccaattccgtgaaggcactcagattgaccgtgttgtacttgactgtatcact
agccttcaaaacggtgctgacttactttggatcgaaactccgactccaaacgtacaagaa
attgcacacatggttaaccgtgtaaaagaagtagttccgaatgcgaagcttgtttataac
aacagcccatcattcaactggactttaaacttccgtcaacaagcgtacgatcgttgggtt
gcagaaggtaaagatgtatctgcttacgaccgtgctaaattaatgagcgctgagtacgac
aatactgaattagctgctgaagctgatgaaaaaatccgtactttccaagcagatgctgcg
cgtgaagctggtgtgttccatcacttgatcacacttcctacataccacactgctgctctt
tctactcatgaattagcacaaggttacttcggtgaccaaggtatgttagcttatgttgct
ggcgtacaacgtaaagaaatccgtggcggtatcgcatgtgtgaaacaccaagcaatggct
ggttctgacatcggtgatgaccacaaagaaatcttcgctggtgaaaatgcacttaaagct
ggtgacgatgctaaaaacacaatgaaccaattctcagctcactaa

DBGET integrated database retrieval system