KEGG   Acinetobacter baumannii ACICU: ACICU_01170Help
Entry
ACICU_01170       CDS       T00710                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:abc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1272098..1273114
Genome map
AA seq 338 aa AA seqDB search
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGR
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFV
VRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRRETKKPFEDLSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGDHVRLFNNMDEGITGCDVII
ALRIQNERIDSPALSSQSEFYRMYGLNKERLSLAKPDCIVMHPGPMNRGVEIDSSIADGE
QSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIEAIAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcagcgttgcatcaaccgagccaggttcagctcaatcaagacggaaattta
aaacattttttaacgattgagggcctttcaaaagaaaacctcactaagattttagatacc
gcgcaaagctttttagatgataataataatttaattaaccgcccgcttttagaaggtcgg
acggttatgaatctcttctttgaaaactccacccgtactcgtactacttttgaagcagca
gcaaaacgtttgtctgccaatgtattgaacattgatattgcacgttcaagcacgtcaaaa
ggtgagactttacgagatacgctttggaacctcgaagcaatggctgccgatatttttgtt
gtacgtcattcatcttcaggtgctgcacatttcattgctaaagatgtatgtccgaaagtc
gcaattattaatgccggagatggacgtcatgcccatccaacgcaagcgatgctcgatatg
ctcactattcgccgtgagacgaaaaaaccatttgaagacttgagtgttgccattattggt
gacattaaacactctcgcgttgcgcgttcagatgtagctgcacttcaaacactcggatgt
aaagatatccgtgtgattgcgccgaacaccttattaccggttggtttttcagaatatggc
gaccatgttcgtttgttcaataacatggatgaaggcattaccggttgtgatgtgattatt
gctttacgtattcaaaatgaacgtatcgattcaccagcattatcttcacaatctgaattt
tacagaatgtacggtttaaacaaagagcgccttagcttggctaaaccggactgtattgtt
atgcatccgggaccaatgaaccgtggtgtagaaattgattcgagtattgctgatggcgaa
cagtcagtgattttaaaacaggtcactaacggtattgcagttcgtatggctgtgctagcg
ttgtctatgcaagggcaactccaagaacaaggtttaattgaagcgattgcgttgtaa

DBGET integrated database retrieval system