KEGG   Acinetobacter baumannii ACICU: ACICU_01225Help
Entry
ACICU_01225       CDS       T00710                                 

Definition
sugar phosphate isomerase
Orthology
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
abc  Acinetobacter baumannii ACICU
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325322..1326299
Genome map
AA seq 325 aa AA seqDB search
MPNPTDFQSSALATLRIEQQAIDVLATQIDDRFNRACEILLQCKGRVVITGMGKSGHIGR
KMAATFASTGTPSFFMHPGEAGHGDLGMLVRGDVLIAISNSGKSDEIMMLMPLIKHLGVP
LITISRDDKGPMPQNADIALTLGESDEACPLGLAPTSSTTATLVLGDALAVALLEARGFT
ADDFARSHPAGALGKRLLLHVKHLMHTGDELPKVSPNTPMNQVLYEISNKRLGLTTIVDE
QDHLLGIFTDGDLRRLIDKQQGFDVNLPVSEVMTKKPSTISQEARAVEALQQLNQKKISQ
FVVVDDQNKVIGVISMHDLIQAGVN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcctacagatttccaaagcagtgcattagcgacattgcgtattgagcaacaa
gccatagatgtattagcaacacaaattgatgaccgttttaatcgtgcttgtgaaatatta
ttacaatgcaaaggtcgtgttgtgatcacgggtatgggtaaatctgggcatattggccga
aaaatggcagcgacatttgcttcgacaggcacgccgtctttctttatgcatcctggcgaa
gcagggcatggcgatttaggaatgctcgttcgtggtgatgtacttattgcaatttccaac
tcgggaaaaagcgatgaaatcatgatgttaatgccactcattaagcatcttggtgtacct
cttattacgattagtcgtgatgataaaggcccaatgccgcaaaatgcagatattgcttta
actctgggtgagtctgacgaagcatgccctttaggtttagcgcctacttcaagtacgaca
gcgactttggttttaggcgatgctttagcagttgctttacttgaagctcgtggttttact
gctgatgactttgctcgttcgcatccggcaggtgcgttgggtaagcgtttactgttacat
gtaaaacatttaatgcatacaggcgacgagttaccaaaagtttcacctaatactccaatg
aatcaagtgctttacgagatctcaaataagcgtttaggtttgacaacaattgttgatgaa
caagaccatctactcggtatttttacagatggggatttacgtcgtctcatcgataaacaa
caagggtttgatgtaaatttacctgtgtctgaagtgatgacaaagaaaccgtcaacgatc
tctcaagaagcccgagctgtagaagctttacaacaacttaaccagaaaaaaatcagtcag
tttgtggtagtcgatgaccagaacaaagtgattggtgtaattagtatgcatgaccttatt
caggcaggggtgaattaa

DBGET integrated database retrieval system