KEGG   Acinetobacter baumannii ACICU: ACICU_01627Help
Entry
ACICU_01627       CDS       T00710                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACICU_01627
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACICU_01627
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_01627
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ACICU_01627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735968..1738133
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLA
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcaggcccacaattagtagtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcgcgctggggttctttatatgatgcactttac
ggttttgatgtaatttcagaagaaggtggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgcg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcagtttgtgggtttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcctacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaggttgaaggttatcgtaactggttaggtttgatgaagggcactcttcaagaatct
atcgaaaaaaatggtaaaacaattgttcgcgctttgaacaaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagcaattttagttgatggcgaagaaattttcgaaggtattatg
gatgcgttggtaacaccattgttgtcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggtcctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccctaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacctgaaaaactgtatt
gctgctgctaaagatcgcacaatctttattaacactgggttcatggaccgtacgggtgac
gaaatccatacctctatggaagctgcaccagttgttcgtaaagaagctgttaaaacacaa
aaatggattgctgcttacgaaaatcgtaacgttgcaatcggtttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccaccaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgaacttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggtggacttaggtgtaggttgttcaaaagttccggatattaac
aatgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagatcttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system