KEGG   Acinetobacter baumannii ACICU: ACICU_01719Help
Entry
ACICU_01719       CDS       T00710                                 

Definition
(GenBank) Recombinational DNA repair protein (RecF pathway)
  KO
K06187  
recombination protein RecR
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACICU_01719
DNA repair and recombination proteins [BR:abc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ACICU_01719
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ACICU_01719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1832672..1833268
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatcttttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcacgaaatttgtgatatttgcgcttcaacagaaagagatgatcaattg
ctttgtgtagttgagtccccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtggacacctttctccattagatggaatcgggccagaagaa
ataggcattccttatctaatccaacggttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcacatgacacgtattgcgcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system