KEGG   Acinetobacter baumannii ACICU: ACICU_01719Help
Entry
ACICU_01719       CDS       T00710                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1832672..1833268
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatcttttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcacgaaatttgtgatatttgcgcttcaacagaaagagatgatcaattg
ctttgtgtagttgagtccccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtggacacctttctccattagatggaatcgggccagaagaa
ataggcattccttatctaatccaacggttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcacatgacacgtattgcgcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system