KEGG   Acinetobacter baumannii ACICU: ACICU_01728Help
Entry
ACICU_01728       CDS       T00710                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACICU_01728
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACICU_01728
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACICU_01728
Enzymes [BR:abc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACICU_01728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1839423..1840628
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFYAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSIATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacaaggattttttggtgagtat
ggaggtcagtttattcctccgcatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttattttatgcaaaacgcctttcagaacagttaggtggcgca
caaatttatttaaagcgtgaagacttaaatcatacgggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggcaaaaagaaagttattgccgaaacgggt
gcgggtcaacatggggttgctttagcaacagcttgtgctctagtgggtattccatgtgaa
atccacatggggcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgctcatttggtgtcagtaactcgcggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaagaatatttaaaagatcctaaaaactttatttatgcgattggttctgtg
gttggtccccatccatttcctaaaatggttcgagattttcaatcaattattggtaaggaa
attaaagagcagacgcatcaacgatttggtaaaaacccagattatgttgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcctttacagcttttttaaatgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccaagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggattggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcattgcaactgaccaagaa
tgtttagatgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgtcgaaagaaaccatgatc
gtggtaaatctgtcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system