KEGG   Acinetobacter baumannii ACICU: ACICU_01737Help
Entry
ACICU_01737       CDS       T00710                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:abc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:abc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:abc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1850109..1851599
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADNEVSDAEIEKFIASLGGSAAQAPAAPSEQSKAETSVPVAEKAEQPLTTAASASAP
AKVAKGDYAVPESLQGYQTSDDLFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKT
VQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPVSVSEQPLQCATQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggacttatt
gccgtatgtgctgataatgaagtttctgatgcagaaattgaaaagtttatcgcatcacta
ggtggttcagcagctcaagcacctgcagcaccttcggaacaaagtaaagcggaaacatct
gtacctgttgctgaaaaagcagaacagccactgactacagcagctagtgcttcagctcct
gcaaaggtagctaaaggggactacgctgtaccagagtcattacaaggctatcaaacatct
gatgatttgtttgcaacaccacatgcgttaaagcttgcagaaaagcacaatgtaaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaagact
gtacaggctgctggtggtcagtggcctgatgttaagcagcaaactcaaactaaagtggtt
aaatctacagctgatgatagccaaattttagcgacgcctgtagcacgccgtttagcaaaa
caatggggcattaacctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaggcagtttactatcgtaataacccagtgtcggtaagtgaacaacctttg
caatgtgcaactcaaccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaa
gcgattgcttcacggttacaggctgcaaaacgtaacgcaccgcatttccgcttagtggtc
gatctcaacgtagaagctttgcaaaaactacgtaagcagattaatgagactgttccacaa
gtgaaactttctattaatgacatgctaattaaggcagcggcggcggcactgattaaagta
cctgaagtgaatgttcaatttgatgaggcgactcaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagca
aatcaaaaatcgttggcacaaatttccgatgacatgcgtgatttggcaactcgtgctaag
actggcaagttacaacctgacgagtttcagggtggtagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattattaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgtgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system