KEGG   Acinetobacter baumannii ACICU: ACICU_01774Help
Entry
ACICU_01774       CDS       T00710                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ACICU_01774
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ACICU_01774
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ACICU_01774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1891038..1891823
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKVVISDMNAEKCQETANSLKERGFDALS
APCDVTDEDNYKQAIELTQKTFGTVDILINNAGFQHVASIEEFPTAVFQKLVQVMLTGAF
IGIKHVFPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SEKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctagagattgctaagaaatttgctcaagaaggtgccaaagttgttatttctgatatgaat
gctgaaaagtgtcaagaaacagcaaactcacttaaagagcgaggttttgatgcattatct
gcaccatgtgatgtgactgatgaagataattataaacaagccattgagcttactcaaaag
acctttggtacggttgatatcttaattaataatgctggtttccaacatgttgcatctatt
gaagaatttccaacggctgtttttcaaaagttagttcaagtcatgttaactggggcattt
attggtattaaacatgtttttccaatcatgaaagctcagaaatatggtcgtattattaat
atggcttcaattaatggcttgattggtttcgctggaaaggcaggttataacagcgctaaa
catggtgtgatcggtctaacaaaagttgccgcattagaatgtgcacgtgatggtattacg
gtaaatgctttatgtccggggtatgtagatacaccattggttcgtgggcaaattgcagat
ttggctaaaacccgtaatgtaagtttagacagtgcacttgaggatgtaattttggcaatg
gttcctcaaaagcgtttgctatctgttgaagaaatcgctgattatgcaattttccttgcg
agtgaaaaagcaggtggggtaacaggccaagctgtcgtgatggatggcggttatacggcc
caataa

DBGET integrated database retrieval system