KEGG   Acinetobacter baumannii ACICU: ACICU_02254Help
Entry
ACICU_02254       CDS       T00710                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00071  Fatty acid degradation
abc00072  Synthesis and degradation of ketone bodies
abc00280  Valine, leucine and isoleucine degradation
abc00310  Lysine degradation
abc00362  Benzoate degradation
abc00380  Tryptophan metabolism
abc00620  Pyruvate metabolism
abc00630  Glyoxylate and dicarboxylate metabolism
abc00640  Propanoate metabolism
abc00650  Butanoate metabolism
abc00900  Terpenoid backbone biosynthesis
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
abc01212  Fatty acid metabolism
abc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACICU_02254
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_02254
   00640 Propanoate metabolism
    ACICU_02254
   00650 Butanoate metabolism
    ACICU_02254
  Lipid metabolism
   00071 Fatty acid degradation
    ACICU_02254
   00072 Synthesis and degradation of ketone bodies
    ACICU_02254
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACICU_02254
   00310 Lysine degradation
    ACICU_02254
   00380 Tryptophan metabolism
    ACICU_02254
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACICU_02254
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACICU_02254
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACICU_02254
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACICU_02254
Exosome [BR:abc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACICU_02254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: ACC57566
Position
2382555..2384123
Genome map
AA seq 522 aa AA seqDB search
MSKTTQENPAVENSAQEKVSNTSKSASNTAKHNSTTPKAATNTPKTTRTRSTTAPARSPR
SKSAASATPSTSSNVAAAPKATKTKTSVQQDKTMSQNTVRRVAILGGNRIPFARSNTAYF
KASNSDMLTAALNGLVERFNLQGKRIGEVVAGAVLKHSRDFNMTREVVLSTDLAPETPAY
DIQIACGTGLQAAFVVANKIALGQIDVGIAGGVDTTSDAPIAVGDGLRKVLLELNVAKTG
KDRLKALTKIDFKKLLDAPSNGEPRTGLSMGEHQAITALEWGITREAQDELAASSHQKLA
AAYERGFFDDLMTPFLGLNRDNNLRPDSTVEKLAKLKPVFGKGETATMTAGNSTPLTDGA
SVVLLASEEWAKENGHEVLAYLSFSETAAVDFIGKSGPKEGLLMAPAYAVPRMLKRANLK
LQDFDFYEIHEAFASQVLSTLKAWEDEKFCKERLGLDAPLGSIDRSKLNVNGSSLGAGHP
FAATGGRILATAAKLINEKGSGRALISICTAGGEGVVAIVEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgagaattctgctcaggaaaaagtgtca
aatacatcaaagtcggcttctaacacggctaagcataacagcactactcctaaagcagca
actaatacaccaaaaacgacacgtactcgttcaacgactgcacctgcacgtagccctcgt
agtaagagcgctgcttcagcaaccccgtctacatcttcaaatgtagctgcagcaccaaaa
gcaacaaaaaccaaaacttctgttcaacaggataaaaccatgagtcaaaacactgttcgc
cgcgttgcaatccttggtggcaaccgtattccatttgcacgttcaaatactgcctacttt
aaagcgtctaattctgacatgctgacagcagcattgaatggtttggttgagcgctttaac
ttacaaggtaaacgtattggcgaagttgttgcgggcgctgttttaaaacatagccgtgac
ttcaacatgactcgtgaagttgtattgagcacagatcttgctcctgaaactcctgcttac
gacatccaaattgcatgtggtacaggtttacaagcagcatttgttgttgctaacaaaatt
gcgcttggtcaaatcgacgtaggtattgcaggtggcgtagatacaacttctgacgcaccg
attgctgtaggtgatggtttacgtaaagttttacttgagcttaatgttgctaaaacaggt
aaagaccgtcttaaagctctaacaaagattgattttaaaaagcttcttgatgcaccaagc
aatggtgaaccacgtactggcctttcaatgggtgagcaccaagcaatcactgcattagaa
tggggtatcactcgtgaagcacaagacgagctagctgcaagcagccatcaaaaacttgct
gctgcttatgagcgtggtttttttgatgacttaatgactccattcttaggtcttaaccgt
gacaacaacttacgtcctgacagtacagttgaaaaacttgctaagttaaaaccagttttc
ggtaaaggcgaaactgcaacaatgacagcgggtaactcaactccgttgactgatggtgct
tctgtggtattgcttgcttctgaagaatgggcaaaagaaaacggacatgaagttttagct
tatctttctttctctgaaacagcagctgttgacttcattggtaagagcgggcctaaagaa
ggcttattgatggctcctgcttatgcagtacctcgtatgcttaagcgtgctaaccttaag
cttcaagacttcgatttctacgaaatccatgaagcatttgcatctcaagtactctctacc
ttaaaagcttgggaagatgaaaaattctgtaaagaacgtcttggcttagatgcaccattg
ggttcaattgaccgctctaaactgaacgtaaatggttcatctttaggtgcaggtcaccca
tttgctgcaactggtggtcgtatcttggctactgcagctaaattaattaatgaaaaaggt
tcaggccgcgcattaatctcgatctgtacagcaggcggtgaaggtgtggttgcgattgta
gaaaaataa

DBGET integrated database retrieval system