KEGG   Acinetobacter baumannii ACICU: ACICU_02680Help
Entry
ACICU_02680       CDS       T00710                                 

Definition
(GenBank) predicted epimerase, PhzC/PhzF
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhzC-PhzF
Motif
Other DBs
NCBI-ProteinID: ACC57992
Position
complement(2849500..2850315)
Genome map
AA seq 271 aa AA seqDB search
MKMYQVDAFTKELFRGNPAAVIIGKEWPNADLMQKIALENNLSETAFVKIIDSENYEIRW
FTPTVEVDFCGHATLASAFVLFKDFTEKKTLNFHVRNLGLFVVHQDEDGKIRMDFPIRKA
QQVEDYPAILRQALTKPFKAVYQNVQAYIVEYESVQDVLDEQPDMNLLKALGKRTAITTT
AMDFAITSKADDQYDCVSRYFAPVAGIDEDPVTGSIHTAIAPLWAEKLAKNNIVAYQASS
RGGVLYCNVLNQERIEISGYGKLYMQAEIFP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtatcaagtcgatgcttttaccaaagagctatttcgtggaaatccggctgct
gtgattattggaaaagagtggccaaatgcagatttaatgcaaaagatagcacttgaaaat
aacttatctgagactgcttttgtaaaaattatagactctgaaaattatgaaatacgctgg
tttactccaacggttgaggtggatttttgtgggcatgcgactcttgcgagtgctttcgta
ttatttaaagattttactgagaaaaagactcttaattttcatgtacgaaacttaggtttg
tttgtagttcatcaagatgaagacggcaaaatcagaatggattttccaattcgtaaagct
cagcaagttgaagattatccggctattttacgtcaagcattaacaaaaccttttaaagcg
gtttatcaaaatgttcaagcctacattgttgaatatgagtcagtgcaagatgtgttagat
gagcaacctgacatgaacttacttaaagccttaggtaagcggactgcaattacaactaca
gcaatggattttgcaatcacctcaaaagctgacgatcaatatgactgtgtttctcgttat
tttgcacctgtcgcaggcattgatgaagacccggttactggttcaattcataccgcaata
gcgccactatgggcagagaaactcgctaaaaataatattgtggcctatcaggcttctagc
cgtggaggcgtattgtattgtaatgtcttaaatcaggaacgtattgaaatttcgggatat
ggcaaactttatatgcaagccgaaatttttccttaa

DBGET integrated database retrieval system