KEGG   Acinetobacter baumannii ACICU: ACICU_02682Help
Entry
ACICU_02682       CDS       T00710                                 

Definition
(GenBank) Transcriptional regulator
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2852056..2852937)
Genome map
AA seq 293 aa AA seqDB search
MLLKSLEFFLAVAESGSFSLAAQKMCTVQSNITSHVKKLEEELGVILLNRHNPVTLTNAG
HQLHSYAVQMIALHNKAKTIFREGDIDPNETIRLGSMETTAAIRLPQLLNECMQQHPNLP
LELQTHPTGYLLNAVQQGEVDCAFVASKYVIPELYSFPVWQEQLVLVCPKQQIDFPDIAT
LAKTRFIAFRQGCSYRHAIELFLNDHSVPPSQIMEMGSLDGIVSCVELGVGFALLPKSYL
NKVADKVSLSCFEINTESAHFTTYLVAQPPETWGSNLKQFICFIEQQFIQKCA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaagtctttagagttttttttagcggttgcagagagtggaagtttttcattg
gctgcacaaaaaatgtgtacggttcaatccaatatcacgagccacgtgaaaaagcttgaa
gaagagttaggtgtgattttattaaatcgtcataaccccgttacattaaccaatgcagga
caccagctacatagttatgctgtgcaaatgatcgcactgcataataaagcgaagacaatc
ttccgagaaggtgatattgacccgaatgaaactattcgtttgggcagtatggaaacgaca
gcagcaatacgacttcctcaattgcttaatgaatgtatgcagcaacatccgaatctgccg
cttgaacttcaaactcacccgacaggatatttgttaaatgctgtgcaacaaggagaagtc
gattgtgcttttgtcgcttctaaatatgtgattccagagctatatagttttccggtgtgg
caagaacaactggttttggtttgcccaaaacaacaaattgattttcccgacattgccacc
ctcgcaaagactcgttttattgcatttcgacaaggatgttcctatcggcatgcaattgag
ttgtttttaaatgatcacagtgtgccaccttcgcaaattatggaaatgggcagtctggat
ggcattgtaagctgtgtggaattaggtgtcggttttgctttattgccaaagtcatatctg
aataaagtagccgataaagtctcattaagttgttttgaaattaacactgaatctgcacat
ttcactacttatttggtcgctcagcctcctgaaacatggggcagtaatctaaagcaattt
atttgttttattgagcaacaatttatacagaaatgcgcttaa

DBGET integrated database retrieval system