KEGG   Acinetobacter baumannii ACICU: ACICU_02683Help
Entry
ACICU_02683       CDS       T00710                                 

Definition
(GenBank) Permease of the major facilitator superfamily
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_4 MFS_1
Motif
Other DBs
NCBI-ProteinID: ACC57995
Position
2853034..2854212
Genome map
AA seq 392 aa AA seqDB search
MSTFYRMSLLVFLATCLGIGIFRFSYTALMPIMIVQYGWTHDFASYLGSANLLGYLVGAL
LALFSIKEKSIPALIMTSAVLGSLSLLCCSFIHMSLAWFILWRTISGIAGGLLMILAPSF
AMKNIAISQRLKVNFLGFSGIGAGVLSATLIIPALKNMPVQYVWEIFAVISIIGSLVLLQ
LLRHPPTESVQTANHAPQNFIHSRLGLVIIIAYMCSAFAYIPHSLFWMDYLSGTLHFPLQ
QRNLFWVLYGVGSCVGAFVAYCLSRLIGYLQAIKCLYGVYCLAVALPFFSHATALLTLSS
FLTGLLTPATVFISSYSLLQIYEQRYQKIWSLATIGFASTQLLGGVVISTLHHLHWSYAH
LFLMGGIVLLFALSLLIPIRSSPPNTLGETKS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgttctatcgaatgagcctgcttgtctttttagcgacttgcctaggaattggt
atttttagattttcctataccgcactcatgcctattatgattgtgcaatatggatggact
cacgactttgcaagctacttaggaagtgcaaatttattgggctatctggttggcgcacta
ttggccctgtttagcattaaagaaaaatctatacctgctttgattatgacttcggcggtt
ttaggcagcttaagcctactctgctgttcgtttatacacatgtctctggcttggtttatt
ctctggcgcaccatttcaggtatcgcaggtggcctactcatgattttagcgcccagcttt
gccatgaaaaatattgcaattagccaaaggctcaaagtcaattttttagggtttagtggt
attggcgcaggcgtgttatctgccactctcattattcctgcacttaaaaatatgcctgtt
caatatgtctgggaaatttttgccgtcatttccattattggcagtttggtacttttacag
ttattaaggcacccacctaccgagtccgttcaaacggccaatcacgctcctcaaaacttc
atacattcacgtttaggactggtcattattattgcttatatgtgcagtgcttttgcatat
atccctcactctttgttttggatggactatttatcggggaccctacattttccattgcaa
caacgaaacttattttgggttctttatggggtcggaagttgtgttggcgcctttgtggcg
tattgtttaagccgccttattggatatttgcaggcaattaaatgtctatacggtgtctat
tgcttggcagttgccctaccatttttttcacatgctactgctttgctcactttatcgtcc
tttcttacaggtttactcacacctgccaccgtatttattagctcttacagcctgctacag
atttatgaacagcgttatcaaaaaatctggagccttgccaccattgggtttgccagcact
cagttattaggtggcgttgttattagtactttacatcacttgcattggtcttatgcccat
ctgtttttaatgggcggcattgttttgttatttgcattgagccttttaattcctatccgt
tcttccccgccgaacactctcggagaaaccaaatcgtga

DBGET integrated database retrieval system