KEGG   Acinetobacter baumannii ACICU: ACICU_02687Help
Entry
ACICU_02687       CDS       T00710                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00020  Citrate cycle (TCA cycle)
abc00480  Glutathione metabolism
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
abc01210  2-Oxocarboxylic acid metabolism
abc01230  Biosynthesis of amino acids
Module
abc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACICU_02687
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACICU_02687
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACICU_02687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACC57999
Position
complement(2855563..2856819)
Genome map
AA seq 418 aa AA seqDB search
MGYQKIVVPADGDKITVKADLSLNVPNHPIIPFIEGDGIGVDITPAMKKVVDAAILKAYG
GKRSIEWMEVYCGEKANKIYGTYMPEETFEALREFVVSIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCVRPVRWFQGVPSPVQHPELTDMVIFRENSEDIYAGIEWKADSEEAKKVIKFLQ
EEMGVTKIRFPEGCGIGIKPVSKEGTQRLVRKAIQFAIDNDKPSVTLVHKGNIMKYTEGA
FKEWGYELALDRFGGELIDGGPWVKIKNPKNGKDIIIKDVIADAFLQQILMRPADYSVIA
TLNLNGDYISDALAAEVGGIGIAPGANIGGAIAVYEATHGTAPKYAGQDKVNPGSIILSA
EMMLRDMGWTEAADLIIKGISGAIAAKTVTYDFERLMPGATLLRCSEFGDAIIQHMED
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggttatcagaagatcgtggttcctgccgacggtgataaaattacagtaaaagcagac
ctgtcactgaatgtaccaaatcatccaattattcctttcattgagggtgacggtattggt
gtagatattacaccggcaatgaaaaaagttgttgatgcggcaattttaaaagcctatggc
ggcaaacgctctattgaatggatggaagtgtattgcggtgaaaaggccaataaaatttac
ggtacttatatgccggaagaaacctttgaagcgctgcgtgaatttgtagtttcaattaaa
ggccctttaactacaccagtcggtggtggcattcgttcacttaatgttgcactacgccaa
gaactggatttgtatgtatgtgtgcgtcctgtgcgttggttccaaggcgtcccttcacct
gttcaacatcctgagttaactgacatggtgattttccgtgaaaactcggaagatatttat
gcaggtattgaatggaaagcagattctgaagaagctaaaaaagttattaaattccttcaa
gaagaaatgggggtcacaaaaattcgtttccctgaaggatgtggtattggtattaaaccc
gtttccaaagaaggaacacagcgcttagttcgtaaggccattcagtttgcaatcgataat
gacaaaccttcggtgactcttgttcataaaggcaacattatgaaatataccgaaggtgcc
tttaaagaatgggggtatgagttagcgctagatcgtttcggtggtgaattaatcgatggt
ggcccatgggttaaaattaagaatcctaaaaatggtaaagacatcattattaaagacgtg
attgcagatgctttcttgcaacaaatcttgatgcgtcctgctgactactctgtaattgca
acccttaatttaaatggtgactatatttcagatgctttagcagcagaagtagggggaatc
gggattgcgccaggtgcgaatattggtggagctattgcagtgtatgaagcaacgcatggc
actgcacctaaatatgctgggcaagataaagtcaacccgggttcaattattctctctgct
gaaatgatgctccgtgatatggggtggacagaagcagcggacctgattattaaaggtatt
tcaggagcgattgcagctaaaaccgtaacttacgattttgagcgtttaatgccgggagcg
accttgttacgttgctcagaatttggcgatgccataattcagcacatggaagattaa

DBGET integrated database retrieval system