KEGG   Acinetobacter baumannii ACICU: ACICU_02690Help
Entry
ACICU_02690       CDS       T00710                                 

Definition
(GenBank) predicted protease with the C-terminal PDZ domain
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M61 PDZ_2 PDZ Peptidase_M1 Suppressor_P21
Motif
Other DBs
NCBI-ProteinID: ACC58002
Position
complement(2860564..2862267)
Genome map
AA seq 567 aa AA seqDB search
MLHYQIEFDDYKQHLVHVTIRFLANPNQELWLPTWIPGSYLIREFSKHIEAVKAYDEAGR
MLNIKKTEKNRWRLFNTDHELITVEYDVYAYDLSVRGAYVDQTRLYINPACVCLGLEGQE
QSACELEIFLPDELKHFQLATGLASKSLVKGRFTLKADHYDQLIDSPFELADQTRFSFET
HGIEHEFVISGTHATNVDRLKTDIEKICAAEIDLFGSAPFKNYTFMTMATGNSYGGLEHC
NSTSLITPRDDLPKSNEPTEPSKDYQRFLGLCSHEYFHSWLVKFIRPENFANYNLHQEGY
TSLLWIFEGFTSYYDDLILLRSGVISQKSYLDLLKSQIDRYLQNPGRFVQTVAESSFDAW
IKFYRQDENSNNAGTSYYNKGALVALCLDLGLRLRGSSLDALMRRLYENTQNGVQVNERT
IFDLCEELTGDSWLEQINHLINTTEELPLDQLFPEFGLSYTLKNDKTLAYGLKLADKPEG
VLVQNAHREGAGAKAGISANDVIIAIDGLKATTKLIEKYAKQKGNYSVLAFRRDELLSFE
VTSDSINLTEVELIIEDQSKADKWLKA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgttgcattatcaaattgagttcgatgattacaaacaacaccttgttcacgtgacaatt
cgctttttagcgaatccaaatcaggaactatggttaccaacgtggattccgggcagttat
ctcattcgagagttttctaagcacatcgaggcagtaaaggcctatgatgaagctggacgc
atgctcaatattaaaaagactgaaaaaaatcgctggcgtttatttaacaccgatcacgag
ttaattactgttgaatatgatgtttatgcatatgatttatcagtacgtggcgcttatgta
gatcaaacgcgtttatatattaaccctgcctgtgtgtgtttaggcttagaaggccaagaa
caatctgcatgtgaattagaaatctttttgccggatgaattaaaacactttcagttagca
acaggattagcttcaaaaagtttagtaaaaggacgttttactttaaaagctgatcattat
gatcaactcattgatagtccatttgaactggctgatcaaacgcgttttagcttcgaaacg
catggaattgaacatgagtttgtaatttcaggtactcacgctacgaatgttgatcgttta
aaaacggatattgaaaaaatttgtgcagccgaaattgatctgtttggttcggcaccgttt
aaaaactataccttcatgaccatggcaacagggaatagttacggtgggctagagcattgc
aatagcacaagtctgattactccacgagatgatttgccgaaatcgaatgaacctactgaa
ccttcgaaagattatcaacgtttcttaggtttatgcagtcatgaatattttcattcttgg
ttagtaaagtttatccgtccagaaaattttgcgaactacaacctgcatcaagaaggctat
acctcgctactgtggatttttgaagggtttacttcgtattacgatgatttaattttatta
cgtagtggcgtgatttcccaaaagtcttatttagatttgttgaagtcacagattgatcgc
tatttgcaaaacccgggacgttttgttcaaacagtagcagaatcaagttttgatgcttgg
attaaattttatcgtcaagatgaaaattcgaataatgcaggcacgagctattataacaaa
ggtgcattagttgccttgtgtttagacttaggcttacgtttacgtggttctagccttgat
gccttaatgcgtcgattgtatgaaaatacgcaaaacggtgttcaggttaatgagcgtaca
atttttgatttatgcgaagagctaacaggtgatagttggttagagcaaatcaatcatttg
attaatactactgaagagttaccactcgatcagttattccctgagtttggtttaagttat
acgcttaaaaatgataagactttagcttatggtttaaagctagctgataagcctgaaggt
gtgttagtacaaaatgctcaccgtgagggagctggtgctaaagcgggtatttctgctaat
gatgtcattattgcaattgatggactaaaagcgaccacaaaacttattgagaaatatgct
aaacaaaagggtaattactcagtcttggctttccgccgtgatgagttattgtcgtttgaa
gttacaagtgacagcataaacttaactgaagttgaacttattattgaagatcaaagcaaa
gctgacaaatggttaaaagcctaa

DBGET integrated database retrieval system