KEGG   Acinetobacter baumannii ACICU: ACICU_02692Help
Entry
ACICU_02692       CDS       T00710                                 

Definition
(GenBank) NADH dehydrogenase, FAD-containing subunit
  KO
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ACICU_02692
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     ACICU_02692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2863858..2865144
Genome map
AA seq 428 aa AA seqDB search
MTQNLHHIVIVGGGAGGLELATQLGETFGKNGKAKITLVDQNLTHIWKPLLHEIAAGSLN
PHEEQTNYFAHAKKHHYEFVLGTLTAVNKDKKIIDLIPPQVSKEQNTHIQQLSYDTLVLA
LGSVSNDFNTPGVRENCHFLDSRKQADIFQQDLLHLYIEAQNQPDQRTLNIGIIGAGATG
VELAAELIETTKNFYRYGLKKIHPNQVKITLIEASERILPALSEKTAEHSAKQLQKMGVE
ILTKHRVEKIDEHCIYFSNGNQLNSDITVWAAGVKAPKVLESLSDFERDNINRLMVYATL
QTYSDPNVFAFGDCAHCQLDARHPPLGPRAQVASQQASFLVDAMAARLNGRSQPMFTFND
KGSLVSLSRNKAVGELLGDVSVQGYIAKTMYVSLYRLHQATIHGYTQAGLLTMKDLLTRR
VRPKIKLY
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaacttacatcatattgttattgtcggtggtggtgctggtggtttagaactc
gccacacaacttggtgaaacttttgggaaaaatggtaaagccaaaattacattggttgac
caaaatttaactcatatctggaaaccattacttcatgaaattgcggcgggttctttaaat
cctcacgaagagcaaaccaattattttgcccatgcaaagaaacaccactatgaatttgtg
ttgggaacattaacagcagtaaataaagataagaaaataattgatttaattccccctcaa
gtctctaaagaacaaaatacccatattcaacaactcagttacgatacactggttttagcg
cttggttcagtatcaaatgatttcaatacacccggtgttcgtgaaaactgccatttcctc
gatagccgtaaacaggcggatattttccagcaagatcttttacatttatatatcgaagcg
caaaatcaacccgatcaacgtacattaaatattggaattattggtgcgggggcaacaggt
gtcgaacttgcggctgaactgattgaaacgaccaaaaacttttatcgctatggtttaaaa
aagatccatccgaatcaagtcaaaattacactcattgaggcctcagaacgcatcctccct
gccctaagtgaaaaaacagctgaacatagcgcaaaacagcttcaaaaaatgggtgttgaa
attttaactaagcaccgggttgaaaaaattgatgaacactgtatctattttagtaatggt
aaccagctcaacagtgatattacggtatgggcagctggggtaaaagcaccaaaagtactt
gaaagtcttagcgatttcgaacgtgacaatattaaccgcttaatggtctatgcaacgctg
cagacctattccgatcctaatgtatttgcatttggtgattgtgcgcattgccaacttgat
gcaagacacccgcctctcggaccacgcgctcaagttgctagtcaacaagcaagcttttta
gtcgatgctatggctgctagactaaatggtcgatcacaaccgatgtttacttttaatgac
aaaggttcacttgtgtctttaagtcgtaataaagcggttggagaattactgggggatgtc
agtgtccaaggatatattgccaaaacgatgtatgtatctttataccgtttacatcaagca
acaattcacggatacactcaagctggactactcacaatgaaagatttacttacaagacga
gtacgaccaaaaattaagctgtattga

DBGET integrated database retrieval system