KEGG   Acinetobacter baumannii ACICU: ACICU_02693Help
Entry
ACICU_02693       CDS       T00710                                 

Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase 2
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ACICU_02693
Chaperones and folding catalysts [BR:abc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    ACICU_02693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C GreA_GreB
Motif
Other DBs
NCBI-ProteinID: ACC58005
Position
2865280..2865762
Genome map
AA seq 160 aa AA seqDB search
MTAIANNHVVSFHYKLTNAEGETLDQSQGEPLAYLHGAGNIIPGLENALTGKTVGDKFTV
NVPAAEGYGEYNPDLVQEVPAQMFQGVDNIQPGMQFQAQTDDGVQIVTVKAVEGDNVIVD
ANFPLAGQDLTFEVEIVEIREASQEELDHGHVHGAGGHHH
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaattgcaaataaccacgtggtttcattccactataaattaacaaacgctgag
ggtgaaacacttgatcaatctcaaggtgaaccacttgcctatttgcatggcgcaggcaac
atcattcctggtttagaaaatgcattaactggtaagactgttggtgataaattcactgtt
aacgtaccagctgctgaaggttatggcgaatataacccagacctagtacaagaagttcct
gctcaaatgttccaaggcgttgataacattcaaccaggtatgcaattccaagctcaaaca
gatgacggcgttcaaatcgttactgttaaagcagttgaaggtgacaacgttatcgttgat
gcaaacttcccacttgctggtcaagatttaacttttgaagttgaaatcgtagaaatccgt
gaagcttctcaagaagaattagatcacggtcacgtacacggtgcgggtggtcaccaccac
taa

DBGET integrated database retrieval system