KEGG   Acinetobacter baumannii ACICU: ACICU_02694Help
Entry
ACICU_02694       CDS       T00710                                 

Definition
(GenBank) Deoxyribodipyrimidine photolyase
  KO
K01669  deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     ACICU_02694
DNA repair and recombination proteins [BR:abc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    ACICU_02694
 Prokaryotic Type
    ACICU_02694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_7 DNA_photolyase
Motif
Other DBs
NCBI-ProteinID: ACC58006
Position
2865866..2867308
Genome map
AA seq 480 aa AA seqDB search
MSNAYQLIWFRQDLRIHDHAALWHASQQGPSLGLVILSPEQWKQHADAPIKISFYLRQLR
TLQKELAALHIPLVIQVIPYWKEIANFISDFSKKYNIENVYANIEIGVNELKRDKNVQDY
LNRHGKELFLFHDRTIFPLRSIRNQSQQPYQVFSAFKKACYTKLDTSGLSQCYPVPNKQN
EVPLDFLQGKNIDLDEIEKLFCSSLSKEQQDLWPVGEQYALEQLDQFIEESVCHYKVERD
FPHIQATSKLSPYLNIGILSIRQCLQALFRNQHGNFHLVNEGQQTWLDELLWREFYQHIL
FDFPHVSKHIPFKKDTQKIKWNHNPEHLTAWQTGQTGIPIVDAGMRQLLQTGWMHNRVRM
ITAMFLCKNLLIDWRIGEQWFMQHLIDGDLAANNGGWQWCASTGTDAVPYFRIFNPIAQS
KKFDPEGEYIRQWIKELTHLDNKTIHDPYSSKTDLGLNYPKPIVDLKETRLKAIETFKNI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgcttatcagctcatttggtttcgccaagatttgcgtatacatgatcatgca
gctttatggcacgccagccagcaaggaccttcactcggtttagtcatcttatcgccagag
caatggaaacaacacgccgatgctccaataaaaataagtttttatttacgacaactcaga
acgcttcagaaagagttagcagcacttcatattccactagttattcaagtcattccctat
tggaaagagatcgcaaactttatttctgatttcagcaagaaatataatattgaaaacgtg
tatgccaatatcgaaataggcgtaaatgaattaaaaagagataaaaatgtacaagactat
ttaaatcggcatggcaaagaactatttttattccatgaccgtactatttttcctttacgt
tcaatccgtaaccaatcacaacaaccatatcaagtatttagtgcattcaaaaaagcttgt
tatacaaagctcgacacaagcggtttatctcaatgttatccggtccctaataaacaaaat
gaagtaccactagattttttacaggggaaaaatattgatttagacgaaattgaaaaacta
ttttgctcatctctctcaaaagaacagcaagatttatggcctgttggcgaacaatacgca
ttagaacaattagatcaatttattgaagaatcggtttgtcactataaagtcgagcgcgat
tttcctcatatacaagctacaagtaagctttcaccttatttaaatattggtattttatct
attcgacagtgtttacaagcactctttcgcaatcaacatggcaactttcacttagtcaat
gaaggccaacaaacatggttagacgaacttctttggagagagttctaccaacatatttta
tttgattttccgcatgtttctaaacacatcccgtttaagaaagatactcagaagattaaa
tggaaccataatccagaacatttaaccgcatggcaaacgggtcaaaccggtattcctatt
gttgatgctgggatgcgacaacttttacaaacaggctggatgcataatcgagtacgtatg
attacggccatgtttttatgtaaaaatcttttgattgattggcgcattggtgaacaatgg
tttatgcaacatttaattgatggtgacctcgccgcaaataatggcggttggcaatggtgt
gcctcaacaggaacagatgccgtaccttattttcggattttcaacccaattgctcaatca
aagaagtttgatccggagggtgaatatattcgccaatggataaaagaattgactcatttg
gacaataaaacgattcatgacccctactcaagcaaaaccgatcttggtttaaattatcca
aaacccatagtagatttaaaagaaacacgccttaaagcaattgaaactttcaagaatatt
tag

DBGET integrated database retrieval system