KEGG   Acinetobacter baumannii ACICU: ACICU_02698Help
Entry
ACICU_02698       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2870377..2872221
Genome map
AA seq 614 aa AA seqDB search
MKKTFDLYQTAQVLLASTSFLLGMSTHAYTWKLDDISTSTKYTVEPHFFYIGKGAEWQNI
QFSSDYSTENDTTVLVKYDDKLIYNTTLNGDGQFKFNIPASQSGFHRLDFIIQQYAKPTT
LNQTKETFCTEDIDHLTYLSNSQLDFTPIRNEYRLKDLPDALFNPQARRPTPFVGILKYN
RKEITEASMLGRLVSSWSSVTPIEWVDSGQTNLNPETNFIIEVIRSASPLKGGALVQIAK
LAEGVPTLSITYHTPQELTAAINGLINPTYVQQLDTGSAIFPTTISAPAWAQFKKIDTLA
DLGIQDFRLNHAEKNLFLDFPAVWQPTDILQGQIALRIQSGLLQGSNITAWIDGGLAGSM
KTADLASDPVNRQFNIFAKEISNTTNFSLKLENSVIANSQCLPNAHGSLWVDTAKSTVKL
PHKLKNGVAALSMTLATKPTIAIDDQSGALNIAIILGQVAKNMLLTQAPMPVNLVRFSPT
SPQAVNVRVNKEIYQQQVLMHQNIIYAPAAANGFIVSYNNNRFDVITDSENGAQTFMHLW
GKIQHKIPNNVTKMLVSENGNIYVLQKLIVGNQKAPLVQQSSFFLLVVIISAIMIIVIFL
WYWLRRNNEKTDTN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacttttgatctttaccaaacagctcaagtgctccttgccagcaccagtttt
ttgcttggcatgtctactcatgcttatacatggaaactcgacgatattagtacctcgact
aaatatacagtcgagcctcactttttctatattggaaaaggtgctgaatggcaaaacatt
cagttttcgagtgactactcaactgaaaatgacacaacagtactcgtcaaatatgacgat
aagctcatttataacactacgcttaatggtgatggccaattcaaatttaatattcctgcc
agtcagagtggttttcaccgtttagattttattattcaacaatatgcaaaaccaacgacg
cttaaccaaacaaaagaaacattctgtacagaagatattgatcacttaacttatttgagt
aattctcaactcgactttacgcctattcgaaatgagtaccgtttaaaagatctaccggac
gctttatttaaccctcaggctagacgacctacaccttttgtcggaattttaaaatataac
cgtaaagaaattaccgaagcctctatgttgggccgattagtaagttcgtggagctccgta
acgccaattgaatgggttgattcaggccaaaccaatctaaatcctgaaacgaactttatt
attgaagtgattcgttcggcaagcccactcaaaggaggagccttagtacaaattgctaaa
ctggctgaaggtgtaccgacgctatctattacttatcacactccacaagagcttaccgct
gccattaacgggctaattaatccaacttatgtgcaacagcttgatacgggtagcgctatt
tttccaactacaatctcagcaccagcttgggcgcaatttaaaaaaattgatacgcttgca
gatctaggtattcaggattttcgactaaatcatgccgaaaagaatttatttcttgatttt
ccggcagtatggcaacctactgatattctgcaagggcaaatcgcacttcgtattcaaagt
ggactattacaaggttcaaatattacagcatggattgatggaggacttgcaggaagtatg
aaaacggcggatctcgcatccgaccctgtaaaccgacagttcaacatctttgccaaggaa
atttcaaatacaaccaactttagcttgaaacttgaaaactcggttattgccaattctcaa
tgtttacccaatgctcacggctcactttgggttgataccgccaaatcaacggtaaaactt
ccccataaacttaaaaatggtgttgctgctctttcaatgaccttagccaccaagccaacg
attgcaattgatgaccaatcaggggcattaaatattgccattattttaggacaagtcgct
aaaaacatgctgctgacacaggcaccaatgccagtgaacctagtacgcttctctccgact
tccccacaagcagtgaatgtgagagtgaacaaagagatttatcagcaacaagtcttaatg
catcaaaatattatttatgcacccgcagcagcgaatggctttatcgtaagttataacaat
aaccgcttcgatgtaattacagactctgaaaacggtgcacaaacctttatgcatttatgg
ggaaaaatacagcataaaatcccaaataatgtgaccaaaatgctggtgtctgaaaacggc
aatatttatgttcttcaaaaattaattgtaggtaatcaaaaagcgccattagttcagcaa
tcatcattctttttattagttgtgattatctctgcaattatgataatagtgatcttcttg
tggtattggttacgacgtaataatgaaaaaacagataccaattaa

DBGET integrated database retrieval system