KEGG   Acinetobacter baumannii ACICU: ACICU_02713Help
Entry
ACICU_02713       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792 Asp-Al_Ex TMEM107 Phage_holin_3_6 DUF1772 AtpR Sensor_TM1 VIT1 ABC2_membrane_3 DUF2157 DUF4131 TarH DUF2254
Motif
Other DBs
NCBI-ProteinID: ACC58025
Position
complement(2883147..2883371)
Genome map
AA seq 74 aa AA seqDB search
MTSEQTRAYLAFALVALMFVLVIALFFVNMPRENSNLINTALGFIAGAMTTACGFYFGSS
DQEKKNKTEESTEQ
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgaacagactagagcttatctggcttttgcacttgtggcgttaatgttcgta
ctggttattgctttattttttgtgaatatgccacgtgagaacagcaatttaattaataca
gcattgggtttcattgcgggggcaatgacaactgcctgtggattctatttcggaagctct
gaccaggaaaagaaaaataaaactgaggaatcaactgagcagtaa

DBGET integrated database retrieval system