KEGG   Acinetobacter baumannii ACICU: ACICU_02722Help
Entry
ACICU_02722       CDS       T00710                                 

Definition
(GenBank) Phage-related protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_min_tail DUF2460 DUF5119
Motif
Other DBs
NCBI-ProteinID: ACC58034
Position
complement(2898467..2898808)
Genome map
AA seq 113 aa AA seqDB search
MSDLKFTFECDLEGNNQTQRFNTLSTKFGDGYEQNTSIGINNRSGEWTYQRTAKKAEILE
IKAFFDKHKGANSFLWDSPLDGEVRVKAGDYQPVCLGGDTWRITTTFTQVFYP
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttaaaatttacctttgagtgtgatcttgaaggtaataatcaaacccaacgt
tttaatacgttatcaacaaaatttggtgacggatatgaacaaaatacttcaattggtata
aacaatcgatctggtgaatggacctatcagcgcacagctaagaaagctgaaattttggaa
attaaagcattctttgataagcacaagggtgctaattcttttctatgggattcgccgtta
gatggtgaagtgcgcgttaaagcaggggattatcaacctgtttgcttgggtggagatacg
tggcgcattacaaccacatttactcaagttttctatccataa

DBGET integrated database retrieval system