KEGG   Acinetobacter baumannii ACICU: ACICU_02723Help
Entry
ACICU_02723       CDS       T00710                                 

Definition
(GenBank) Phage-related minor tail protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Rsa3 Ribosomal_S30AE
Motif
Other DBs
NCBI-ProteinID: ACC58035
Position
complement(2898926..2902891)
Genome map
AA seq 1321 aa AA seqDB search
MTQESRLVITIDSKNAERNARNLGNELDSIEKKGDFASKSMDSLSVATRALAGHMAGLVT
VGAAISKMDEYTGLQNRLKLVTKNQVELNKATEDTFRIAQKTYATWNSVLQVYQRFSDNA
KTLNINMDETARLTETVSKAVAISGASAQAADAALVQFGQALASGTLRGEELNSVMEQTP
ALAKAIAQGMGITVGQLRSVAAEGKITSKEIVKALKNVQDDVDALFAKTDITIGQSLTLL
NNEITKFVGESGKGSGAAHVLADSIQLLASNLKLISDGALVLGIGLVTKAIATKTVAVYA
DVAATAANVKASKEKVIADAAEAAAAVKTAQAQIANSQATLQVLAAEKALEVERLKAQMN
AVGRTQSITRMAELKKIEAQVTRELAAAETALAAAQTKANATKVTALTTLGRLGKGALGL
VGGPIGALALGVSALAATYTYFKDKAEEANKKLEEQAAVANRSATELKNLQGQAKTDAIK
DLTTAFKAQNDELTKMEYRVGSALIDIQNYAQGNAEVARISNEARLGTISYQEALQQLAK
VKLPPSLRQALEEQIEKYKDAYDKADKTKTAIKLFGIEVTISGNKAQNAAIEQQKHADAI
KNTKQAADEAQKSLKEMYDQKNLDTDFLTINIKSHGLEMGKALSDFYDNNKIPKTRSLTK
DEWAIFQKNFDKVQELKKLEEDITASKRQQTKELEKQQKVLAVNSQVKSNASKYNFSDLE
SKYDLLPGLLSAINMQESRGDANVIGPNTKYGKAKGGFQMLDGTAKRWGLVGKEVFDTGK
AAEAAAKYLNFLFKKFGNWDQAISAYHAGEGNVEKGTNIGPVNRQYVKNVKGYIAGSNGF
DMKGVSEKDFDSYLNQFLKTQEETEKLRDQYRDKDTLAEKEYLKRIGELKLHFKDAELKQ
LTDKETARYNAQKELNAEQLEFELNEFRLNEVQKLEKQKQIKLLQIKASTEYSETEKEIR
IKAVNAMFDYEISEYRKLQKQKLEEYRKTMYEQASIPQSDVINLLAKKNLTSSQYDSWNL
QNQYSDEMQNANDAYSSNVKAISEDKTIVDEEKRFQALLDAEELFRQQKYAINEKYTLME
QELQKNARQAEMEVYGQLLSQASTVWGNMTAMVKESAGEQSSAYKAMFFVQQGIAIAQGI
ISTELAAAKALELGPVLGIPAAAVVRGLGYASVGLIAAQTIAGFSDGGYTGNGLKHTPAG
IVHKGEVVWSQEDIKRWGGVSVVESMRQSNPSGYANGGYVSNNQSDAIAIRRESRQFEAI
NSNQSQLNTNEKPINVYVTVNADGTSKTETENDSKQLGQMIGNAVRTIIRQEQRQGGLLS
K
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagaatcacgtctagtcattactattgattcgaaaaatgcggaacgaaacgca
agaaatctaggcaatgaactcgacagcatagaaaagaaaggggattttgcatcaaagtcc
atggatagtttatctgtagcaacaagagcacttgctggacacatggcaggtcttgttacg
gttggcgcggccatatccaaaatggatgagtatacaggcttacagaacagacttaagtta
gtaaccaagaatcaagttgagctaaataaagcaactgaagatacatttagaattgctcaa
aaaacttatgcgacatggaattcggttttgcaggtctaccagcgttttagtgacaatgcg
aaaacactaaacataaacatggacgaaacggcccgcttaactgaaacagtatcgaaagct
gttgcaattagtggagcaagtgctcaagcagctgatgcagcactagttcaatttgggcaa
gcattggctagtggaacacttagaggtgaagagcttaactctgtgatggagcaaacccct
gccttagcaaaagcgatcgcacaagggatgggtattactgtagggcaactacgttcagtt
gctgctgaagggaagattacatcaaaagaaattgttaaggcccttaaaaatgttcaagat
gacgttgatgctctttttgcaaaaacagatatcactatcggtcaatcactcactctttta
aataacgagatcacaaaatttgtcggcgagtcaggaaagggaagcggtgcggctcatgtg
cttgctgattcgattcagcttcttgcatcaaatttaaagttgatttctgatggagcactg
gtgttagggattggacttgtaactaaggcaatcgctactaaaaccgttgcggtatatgcc
gatgttgcagcaactgccgcaaatgtaaaagcaagcaaagaaaaggttattgcagatgca
gctgaagcagccgctgctgtaaaaacagctcaggcgcaaatagcaaattcacaagcaaca
ttgcaggttctagccgctgaaaaagcattagaagttgaaagactaaaagcccaaatgaat
gcggtcggtcgcacacaatcaattacgcgtatggccgaattaaagaaaattgaggctcag
gtaacgcgagaattagctgctgctgaaacagcattagcagctgcacaaactaaggccaat
gccacaaaagtgacagccttaacaacattaggacgactcggaaaaggagctttaggactt
gttggtggaccaattggtgcgctcgctttgggcgtttcagccttggccgcaacatacact
tattttaaagacaaggcagaagaggcaaataagaagctcgaggagcaagctgcggtggct
aatcgatcagccacggagttgaaaaatttgcaaggtcaagccaaaacagacgcaattaaa
gacttaacaaccgcattcaaggctcaaaatgatgagcttacaaagatggaatatcgggta
ggttctgcgttaatcgacattcagaattatgcacaaggaaatgctgaagtagctcggatt
tcaaatgaagcgcgtttaggaaccattagttatcaagaagctttgcaacaactagcgaaa
gtgaaattaccacctagcttaagacaggcacttgaagaacaaattgaaaaatataaggat
gcatacgataaagccgataagaccaaaacagcaattaaattgtttggtattgaagtaacc
atatctggtaataaggctcagaatgcagctattgaacagcaaaaacatgctgatgcaatt
aaaaatacaaaacaagcagcagatgaggcgcaaaagtcactgaaagaaatgtatgatcaa
aaaaacttagatactgattttttaacgatcaacattaaaagtcatggactggaaatgggt
aaggcgttatcagatttttacgataacaacaaaatccctaaaactcgcagtttaactaaa
gatgaatgggcaatattccaaaaaaactttgataaggtgcaagagcttaaaaagcttgag
gaggatattaccgcttctaagagacagcaaaccaaggaacttgagaaacagcaaaaagtt
ttagctgttaactcccaagttaaatctaacgcctcaaagtataatttttccgatcttgaa
tctaaatatgacttattgcctggcctgctatcagcaatcaacatgcaagaaagcaggggt
gatgcaaacgttattggtccgaatacaaaatacgggaaagccaaaggtgggttccagatg
ttggatggtaccgctaagcggtggggattagttggtaaagaagtttttgatactggcaaa
gctgcagaagcagctgcgaaatatcttaactttttatttaaaaagttcggcaattgggat
caagcaatttctgcctatcatgctggtgaaggtaacgtagaaaaaggtaccaatattggt
cctgtaaatagacagtacgttaaaaacgttaaaggatatattgctggatcaaatggtttt
gatatgaaaggagtctctgaaaaagatttcgattcctaccttaatcaatttcttaaaacg
caagaggaaactgaaaagctacgtgatcagtatcgagataaagatacgcttgcagagaaa
gaatatttaaaaagaattggtgagttaaagttacattttaaagatgcagagttaaagcaa
ctcacggataaagaaacagcacgttacaatgctcaaaaggagttaaacgctgaacaactt
gaatttgaattaaatgagttccgtttaaatgaagttcaaaagctggaaaaacaaaagcag
attaaattacttcaaatcaaagcatcaactgaatactctgaaactgaaaaagaaattcga
atcaaagctgttaatgcaatgtttgattatgaaatttctgagtacagaaaacttcaaaag
caaaaattggaggagtatcgaaaaacaatgtatgagcaagcctcaataccacaatcagat
gttattaatttactagctaaaaagaacctaacttcttcgcaatatgattcatggaatcta
cagaatcaatatagtgatgaaatgcaaaatgctaatgatgcatattcgtcaaatgttaaa
gcgatctcagaagataaaacaatcgttgacgaagagaagcgcttccaggccttattagat
gctgaagagctatttcgtcaacaaaagtatgccatcaatgaaaaatatacattgatggaa
caagaactccagaaaaatgcccgtcaagctgaaatggaagtatatggccagttattgtct
caagcttctacggtttggggaaatatgactgcgatggtaaaagaatctgctggtgaacaa
agttctgcttataaagctatgttttttgttcaacaaggtattgccattgctcaaggtatt
atcagtacagaattagcggctgcaaaagcattagagttggggccggtattaggtattcct
gctgccgccgttgtacgcggtttagggtatgcctcagttggactaattgcagcccaaaca
attgctggcttctctgatggcggttataccggtaatggtcttaaacacactcctgcaggg
attgtgcataaaggtgaggttgtttggtcgcaagaagatattaaacgctggggtggtgtt
agcgttgttgaaagtatgcgtcaaagcaatccaagtggttatgcgaacggaggttacgtt
tctaataatcagtctgatgctattgcaatacgtagagagtctagacagtttgaggcaatc
aactctaatcaatctcaattgaatacgaacgaaaagccaataaatgtgtatgtcactgtt
aatgccgatggcacaagtaaaacagagacagaaaacgactcaaaacaattgggccaaatg
attggtaatgcagtaagaactattattcgccaggaacaaagacaaggtggtttgttatct
aagtaa

DBGET integrated database retrieval system