KEGG   Acinetobacter baumannii ACICU: ACICU_02732Help
Entry
ACICU_02732       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BSP
Motif
Other DBs
NCBI-ProteinID: ACC58044
Position
complement(2906986..2907390)
Genome map
AA seq 134 aa AA seqDB search
MVNTEYVPEWYITPFQHVQYTLARNQLHMDLLFEDMDEADQFLDMGADAQVSTFSDGAYA
IVQIGDTADKDKIQVYGLLLHEAVHVWQIVKKRMGESEPSVEFEAYSIQAIAQDLFEMYE
ASEVSNGMEGEKAD
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggttaataccgaatatgttccagagtggtacatcacaccttttcagcatgtgcaatac
acgcttgctagaaatcagcttcacatggatttgttatttgaagatatggatgaagctgat
caatttttggatatgggagcggatgcacaggttagtactttttctgatggtgcatatgca
atcgtccaaattggtgatacggcggataaagacaaaattcaagtatatggattgctttta
catgaagcggttcacgtttggcaaatagtaaagaagcgaatgggtgaaagtgaaccaagt
gttgagtttgaagcatattcaattcaagcgatcgctcaagacctatttgaaatgtacgaa
gcaagcgaggtgagcaatgggatggaaggggaaaaagccgactag

DBGET integrated database retrieval system