KEGG   Acinetobacter baumannii ACICU: ACICU_02735Help
Entry
ACICU_02735       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ish1 Filament DUF4686 DASH_Spc19 HeH Mod_r Leu_zip Reo_sigmaC CLZ Cnn_1N Spc7 DUF1664 KASH_CCD GreA_GreB_N IncA Golgin_A5 APG6 T3SSipB
Motif
Other DBs
NCBI-ProteinID: ACC58047
Position
complement(2908163..2908828)
Genome map
AA seq 221 aa AA seqDB search
MKLIYTRIAAAAALEVGTIANPDYYEHPNRSAEEVIIYGDYPKIQNDYQALDIPVEVRKL
EEPAKTTLATVNVAVGITPELQEVIDKTKAECEKVVEENGQLKQKIEILEQASGDSSELI
SENSRLKDAVLQADNATKAAEEKVVSIQAEFDAFKNDVAAMQARIAELEAGKAAENSATE
TAANDFENWSNDQLKEYLASKNIGYKPSATKAELLKLIPKE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaatttatacacgtattgctgctgcagctgcgttagaggttggaactattgcc
aatcctgattattacgaacatccgaatcgaagtgctgaagaagtaattatttacggtgat
tacccgaaaatccaaaatgattaccaagctctggatattcctgttgaagttcgcaaattg
gaagagcctgcaaaaacgacattggccactgtaaatgtagcggttggaattactccagag
ctgcaagaagttattgataaaactaaagctgagtgtgaaaaggttgttgaggaaaacggg
caacttaaacagaaaatcgaaatcttggaacaagctagtggtgatagttcggagttaatt
tctgaaaactcacgtttaaaagatgctgtactccaagctgacaatgctactaaagcggct
gaagaaaaggtagtaagcattcaagcagagtttgatgcttttaaaaatgatgttgctgct
atgcaagcgcgtattgctgaattggaagctggaaaagcggcagaaaattcagcaacagaa
acggcagctaatgattttgaaaactggtcaaatgatcaattaaaagagtatttggctagt
aaaaacattggttacaaaccgtctgcaacaaaagcagaactccttaaattaatcccgaag
gaataa

DBGET integrated database retrieval system