KEGG   Acinetobacter baumannii ACICU: ACICU_02738Help
Entry
ACICU_02738       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2910759..2911073)
Genome map
AA seq 104 aa AA seqDB search
MTKEVTEQELAEKSVAPRVTKAQIDAMMDRVTYTVEQRPGGTTSTFVHAFLDGKFFLATG
FSACVNAENFDAEMGERIARSNAEKSAENKLWELEGYRLFATNF
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaagtaacagagcaagagttagcggaaaagtctgtggcaccccgagtaact
aaagcgcaaattgatgcgatgatggaccgcgttacatatacagtggagcagcgccctgga
ggtacaacatctacttttgtacatgcatttttagatggaaaattttttctagcaacgggt
tttagcgcatgtgtgaatgcagaaaactttgatgctgaaatgggtgagcgtatagctcga
agcaacgcagaaaagtcagccgaaaataaactttgggaactcgaaggctatcgtttattt
gccacaaacttctaa

DBGET integrated database retrieval system