KEGG   Acinetobacter baumannii ACICU: ACICU_02748Help
Entry
ACICU_02748       CDS       T00710                                 

Definition
(GenBank) Site-specific DNA methylase
  KO
K06223  
DNA adenine methylase [EC:2.1.1.72]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:abc00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    ACICU_02748
Enzymes [BR:abc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     ACICU_02748
DNA replication proteins [BR:abc03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    ACICU_02748
DNA repair and recombination proteins [BR:abc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     ACICU_02748
Prokaryotic defense system [BR:abc02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    ACICU_02748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2918001..2918771)
Genome map
AA seq 256 aa AA seqDB search
MKSKPIIPWQGGKTRLAKDLLCKFPEHSCYVELFCGGAALFFLREGPARTEVINDLNGEL
VNLYRVVQNHLEEFVRQFKWCISSRQIFEWEKLKVPDTLTDIQRAARFYYLQQHAFGGKV
SGQTFGYATTGRSLNLLRIEESLSAAHLRLNGVYIENLSWDICFDKYDREHTFFYADPPY
LDTAGYGVDFPLDQYELLSEKMKTCKGKVMLSINDHEKIREIFKGFNFACTSINYSVGRD
LAAKSKKSNELIIMNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaccaataattccatggcaaggtggtaaaacccgtttggctaaggatttg
ttgtgtaagttcccagaacattcatgttatgtggaattattttgtggtggagcagcatta
ttcttcttaagagaaggaccagcaagaactgaagtaataaatgatctgaatggcgagttg
gtaaatctgtaccgggtagtgcagaaccatttagaagaatttgtgcgtcaattcaaatgg
tgcatttcaagtcgccagatttttgaatgggaaaaactaaaagtaccagacacactaacg
gatattcagcgagctgcaagattttattaccttcagcaacatgcgtttggtggtaaggtt
tctgggcagacatttggatatgcaacaacaggccgctctttaaatctcttgcggatagag
gaaagtttaagtgcagcacatttgcgtttgaatggagtctatattgaaaacctgtcctgg
gatatttgctttgataagtatgaccgggaacatacatttttttatgctgatccgccgtat
ctagatacagcaggttatggagtagattttccattagatcagtatgaacttctttctgaa
aagatgaagacttgcaaagggaaggtaatgctatcaattaatgatcatgaaaagattcgt
gaaatctttaaaggttttaattttgcatgtacttcaattaattattctgttggtcgtgat
ttggctgctaagagtaagaaaagtaatgaactgataattatgaattattga

DBGET integrated database retrieval system