KEGG   Acinetobacter baumannii ACICU: ACICU_02759Help
Entry
ACICU_02759       CDS       T00710                                 

Definition
(GenBank) phosphoadenosine phosphosulfate reductase
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: ACC58071
Position
complement(2924046..2924900)
Genome map
AA seq 284 aa AA seqDB search
MIPQELINEIRQNALFVINHSGGKDSQAMMIKLLEFVPKEQILVVHASLGFMEWPGALEL
AQSQAAAAGVDFIVAKASKTFLDMVLKRFSERPEVPSFPSPKYRQCTSDLKRDPIKREVR
RYAKANDFNRIVNCVGLRAEESSHRAKQMIFKPAAENGKAGRTWHDYLPIHSLTTNEVFQ
TIKNAGQSPHWAYQDNDRLSCITCIMASARDLINGATKNPEFYALMCLVEQITGYAMHAS
LRFLPDLTGIHPNYSLLSEYQDLVSKFSNTRSNRKRIQMLEVAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccacaagaactaattaatgaaattaggcaaaatgccctttttgttataaatcat
agcggtggaaaagatagccaagccatgatgataaaactacttgagtttgttcctaaggag
caaattcttgtagttcatgcaagtcttggttttatggaatggccaggagcattagagctt
gcacagagtcaagctgctgcagctggcgttgattttattgtggccaaagcaagtaaaaca
tttcttgatatggttctgaaacgattttctgaacgccctgaggttccttcatttccttca
cctaagtaccgccaatgcaccagtgacttaaaaagagatcctatcaagcgagaggtacgc
cgttacgcaaaggctaatgatttcaatcgaatagtaaattgtgttggtttgcgtgctgag
gaatctagccatcgtgcaaagcaaatgatctttaaacctgcagctgagaatggtaaagca
ggtcgcacctggcatgactatcttccgatacattctcttacaaccaatgaggtttttcag
accattaaaaatgctggtcaatcacctcattgggcgtaccaggataatgatcgtttaagt
tgtatcacttgcattatggcaagcgcgagagacttaattaatggtgcaacaaaaaatcct
gaattctatgcattgatgtgtctggtagaacaaattactggatatgcaatgcacgctagt
ttgcggttccttcctgatctaaccggtatacatcctaattattcacttttaagcgaatac
caagatctagtttcaaagttttcaaatacgcgctctaacagaaaacgtatacaaatgctg
gaggttgcagcatga

DBGET integrated database retrieval system