KEGG   Acinetobacter baumannii ACICU: ACICU_02762Help
Entry
ACICU_02762       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2925675..2925923)
Genome map
AA seq 82 aa AA seqDB search
MTSVQETARIKNQVSSLLAYMKKLGSDSEVQAFAEKCGTTKGNLLQIAYGGSVSPILSKK
ISNQSGGEVLLSDLRPDIFSET
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgttcaagaaacagcacgtatcaaaaatcaagtaagcagccttttggcatac
atgaaaaaacttggctcagattctgaggttcaggcttttgcagaaaaatgtggaacaacc
aaagggaacttattgcaaattgcgtacggcggaagcgtttcacccatcttgtcaaagaaa
atctcaaaccaaagtggtggggaggttttactttccgatctaagaccagacattttttct
gaaacataa

DBGET integrated database retrieval system