KEGG   Acinetobacter baumannii ACICU: ACICU_02765Help
Entry
ACICU_02765       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58077
Position
2927226..2927546
Genome map
AA seq 106 aa AA seqDB search
MKKRYTTPFREFITRDDNGRYHVRLGPQVFSTNLKLDDIRIEGENGSTPVTEGLLKQRPW
ILRNLEQEVKEQRKKEREAIFSKDCFKRTPYSANQKIAYKNARYNG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgctataccacccctttccgcgaatttattactcgcgatgacaatggtcgt
tatcacgttcgtttaggtccacaagttttctctaccaacttaaaacttgatgacattcgt
attgaaggtgaaaacggcagcacacctgtaaccgaaggcctacttaagcaaaggccatgg
atccttcgcaatcttgaacaggaagttaaagaacagcgcaaaaaagaacgtgaagcaatt
ttttcaaaggactgctttaagcgtacgccatacagcgcaaaccaaaaaatcgcatataaa
aatgcgcgttataacggataa

DBGET integrated database retrieval system